DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rrp47 and c1d

DIOPT Version :9

Sequence 1:NP_001285310.1 Gene:Rrp47 / 32558 FlyBaseID:FBgn0030711 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_001016424.1 Gene:c1d / 549178 XenbaseID:XB-GENE-1014449 Length:145 Species:Xenopus tropicalis


Alignment Length:117 Identity:38/117 - (32%)
Similarity:55/117 - (47%) Gaps:6/117 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 DTSLREDE---NMQHILKTFYSSIELLEADTEKALALQAERTL---NTNEQIKLDSYLVYLNSTL 77
            |.|...:|   .:...|..|..|:..::....|.:::.....|   ...||.|||....|..::|
 Frog     3 DESHNTEEYPTEIHEYLMAFDKSVGSVDEMLNKMMSVSRSELLQKIEPLEQAKLDLVSAYTLNSL 67

  Fly    78 FFIYLKLQGEDASNHAVMHDLRRTRDLLARDKKINDALAAPRLDMPAAKRFI 129
            |:|||..||.:...|.|..:|.|.|..:.|.|:|.|...|.:||..||:|||
 Frog    68 FWIYLTTQGINPKEHPVKEELERIRSYMNRVKEITDRKKAAKLDKGAARRFI 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rrp47NP_001285310.1 Sas10_Utp3 32..105 CDD:281929 23/75 (31%)
c1dNP_001016424.1 Sas10_Utp3 22..96 CDD:367765 22/73 (30%)
DUF932 <74..>135 CDD:386282 19/46 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1436833at2759
OrthoFinder 1 1.000 - - FOG0005176
OrthoInspector 1 1.000 - - oto103185
Panther 1 1.100 - - LDO PTHR15341
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2005
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.140

Return to query results.
Submit another query.