DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rrp47 and cti1

DIOPT Version :9

Sequence 1:NP_001285310.1 Gene:Rrp47 / 32558 FlyBaseID:FBgn0030711 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_588415.1 Gene:cti1 / 2539105 PomBaseID:SPCC1739.07 Length:133 Species:Schizosaccharomyces pombe


Alignment Length:132 Identity:38/132 - (28%)
Similarity:56/132 - (42%) Gaps:34/132 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LDTSLREDENMQHILKTFYSSIELLEADTEKALALQAERTLNTNEQIKLDSYLVY-LNSTLFFIY 81
            |:..|...|::...||...|..||.|..:|.             ||.||...:.| :||||:..|
pombe    12 LNKQLDNVEDVLKPLKDAESIFELAEGKSEL-------------EQAKLYITMSYAINSTLYSFY 63

  Fly    82 LKLQGEDASNHAVMHDLRRTRDLLAR----DKKINDALAA---------------PRLDMPAAKR 127
             ||.|.|||...||.:|:|.::.:::    :|.:|....|               |::...||.|
pombe    64 -KLNGIDASERPVMQELQRVKNYISKIQQAEKNVNPKTEAVNTSNAAISSSSSNRPKVAKDAATR 127

  Fly   128 FI 129
            .|
pombe   128 II 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rrp47NP_001285310.1 Sas10_Utp3 32..105 CDD:281929 27/73 (37%)
cti1NP_588415.1 Sas10_Utp3 9..86 CDD:281929 30/87 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4835
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005176
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103626
Panther 1 1.100 - - LDO PTHR15341
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2005
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.890

Return to query results.
Submit another query.