DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rrp47 and Y51H7C.7

DIOPT Version :9

Sequence 1:NP_001285310.1 Gene:Rrp47 / 32558 FlyBaseID:FBgn0030711 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_493965.1 Gene:Y51H7C.7 / 173517 WormBaseID:WBGene00021785 Length:133 Species:Caenorhabditis elegans


Alignment Length:131 Identity:30/131 - (22%)
Similarity:57/131 - (43%) Gaps:17/131 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 ENMQHILKTFYSSIELLEADTEKALALQAERTLNTNEQIKLDSYLVYLNSTLFFIYLKLQGEDA- 89
            :....::.....::|.::...||    ..||  :.:|...:|:..::|..:|.:.....:|..| 
 Worm    16 QKFDELITKLEDAVEEVDVGVEK----HFER--SAHEMALVDTMSMFLMDSLMWAVQATKGGGAD 74

  Fly    90 SNHAVMHDLRRTRDLLARDKKINDALAAPRLDMPAAKRFIAAGTHTRFVDMNGVMVSEKQYNKSK 154
            .|..::.||.||:.:.|..|:||....|||::..||..|:          .|.:....:|...||
 Worm    75 KNDDLLIDLARTKRMTADMKEINLRQDAPRINKQAAANFV----------RNALWEQPEQGESSK 129

  Fly   155 Q 155
            :
 Worm   130 K 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rrp47NP_001285310.1 Sas10_Utp3 32..105 CDD:281929 16/73 (22%)
Y51H7C.7NP_493965.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4835
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1436833at2759
OrthoFinder 1 1.000 - - FOG0005176
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103626
Panther 1 1.100 - - LDO PTHR15341
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2005
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.900

Return to query results.
Submit another query.