DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rrp47 and C1D

DIOPT Version :9

Sequence 1:NP_001285310.1 Gene:Rrp47 / 32558 FlyBaseID:FBgn0030711 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_001177192.1 Gene:C1D / 10438 HGNCID:29911 Length:141 Species:Homo sapiens


Alignment Length:131 Identity:40/131 - (30%)
Similarity:58/131 - (44%) Gaps:15/131 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAQENQAVDNGLPCNAYLDTSLREDENMQHILKTF--YSSIELLEADTEKALALQAERTLNTNEQ 63
            ||.|....|..:..:.||.........:..:|||.  .|..|||:             .|:..||
Human     1 MAGEEINEDYPVEIHEYLSAFENSIGAVDEMLKTMMSVSRNELLQ-------------KLDPLEQ 52

  Fly    64 IKLDSYLVYLNSTLFFIYLKLQGEDASNHAVMHDLRRTRDLLARDKKINDALAAPRLDMPAAKRF 128
            .|:|....|..:::|::||..||.:...|.|..:|.|.|..:.|.|:|.|...|.:||..||.||
Human    53 AKVDLVSAYTLNSMFWVYLATQGVNPKEHPVKQELERIRVYMNRVKEITDKKKAGKLDRGAASRF 117

  Fly   129 I 129
            :
Human   118 V 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rrp47NP_001285310.1 Sas10_Utp3 32..105 CDD:281929 23/74 (31%)
C1DNP_001177192.1 Required for transcriptional repression. /evidence=ECO:0000250 1..100 31/111 (28%)
Sas10_Utp3 18..95 CDD:309214 24/89 (27%)
Interaction with NR1D1. /evidence=ECO:0000250 50..100 17/49 (35%)
Interaction with NCOR1 and NCOR2. /evidence=ECO:0000250 100..141 9/19 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4835
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1436833at2759
OrthoFinder 1 1.000 - - FOG0005176
OrthoInspector 1 1.000 - - oto89350
orthoMCL 1 0.900 - - OOG6_103626
Panther 1 1.100 - - LDO PTHR15341
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2005
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.810

Return to query results.
Submit another query.