DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8924 and ZBTB37

DIOPT Version :9

Sequence 1:NP_573091.1 Gene:CG8924 / 32557 FlyBaseID:FBgn0030710 Length:514 Species:Drosophila melanogaster
Sequence 2:NP_001116242.1 Gene:ZBTB37 / 84614 HGNCID:28365 Length:503 Species:Homo sapiens


Alignment Length:567 Identity:107/567 - (18%)
Similarity:176/567 - (31%) Gaps:175/567 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 SHLGSIGAAFPQLLAGQRFVDVTLACEGQQVHCHRLVLAACSTYFE--------AILAEHPCKHP 70
            |||.       ||....|..|:.:..:||....|::||||.|.||.        :.::....|:|
Human    20 SHLN-------QLRMQGRLCDIVVNVQGQAFRAHKVVLAASSPYFRDHMSLNEMSTVSISVIKNP 77

  Fly    71 VIILPREIKLWEIQALVDFMYKGEVNVTQAGLGQLLRCAEQLQIRGLYGSEAPINYKKLQQASLE 135
            .:          .:.|:.|.|.|.:.:..|.:...|..|..||::.:......|         ||
Human    78 TV----------FEQLLSFCYTGRICLQLADIISYLTAASFLQMQHIIDKCTQI---------LE 123

  Fly   136 AAKDPAATTARSFKHVDSAETDDAATNSTTSTTMTTSSAPPLPVNHQQPTVLKRQNPDARQQQQQ 200
            ..         .|| ::.||.:     :..|.|.|.....| |.:|:....|.|.........:.
Human   124 GI---------HFK-INVAEVE-----AELSQTRTKHQERP-PESHRVTPNLNRSLSPRHNTPKG 172

  Fly   201 QQQQQVQQRPQINGSNAQQPSKATSTNVLGSHSNAPTEDDSGDEVPNNWNAYGEQFDDCNISAQA 265
            .::.||.....|.  ....|.::||..::     .|:.|....|.....|..|:.:.:..::.:.
Human   173 NRRGQVSAVLDIR--ELSPPEESTSPQII-----EPSSDVESREPILRINRAGQWYVETGVADRG 230

  Fly   266 --VDNKMN----VHLSLQQARMQMQLQQQ---------QYLDSNVEDDHNYVAAHDEN------- 308
              .|:::.    ||:..:.....:..:.|         :.:.:.|.|...:.:...||       
Human   231 GRSDDEVRVLGAVHIKTENLEEWLGPENQPSGEDGSSAEEVTAMVIDTTGHGSVGQENYTLGSSG 295

  Fly   309 ------NDSSFATGVPCGSGLSLSLDTD-----------LDTSANTSGGLSHSS---IDGYTSYK 353
                  ..|......|.||.:.|   |:           :|.....|..:..|:   :.||..| 
Human   296 AKVARPTSSEVDRFSPSGSVVPL---TERHRARSESPGRMDEPKQPSSQVEESAMMGVSGYVEY- 356

  Fly   354 RVRRSEAS-----LAQAAKCVSKGETFQTVSNMFNIPVSTIRFYMARKGILPKRKRGRG------ 407
             :|..|.|     ......|:       ..:..||...|..|......||.|...|..|      
Human   357 -LREQEVSERWFRYNPRLTCI-------YCAKSFNQKGSLDRHMRLHMGITPFVCRMCGKKYTRK 413

  Fly   408 -------ASHAGNIIITTNSGKLSTVPASITHPPAHPHI------------------HTN--PL- 444
                   ..|.||                   .|.|.|:                  |..  || 
Human   414 DQLEYHIRKHTGN-------------------KPFHCHVCGKSFPFQAILNQHFRKNHPGCIPLE 459

  Fly   445 -PHTQSQQMSMDSLHLKAGIANTSGSNSPATATATSMSPSFDMATTG 490
             ||:.|.:.::.|   :......|.|.....|...::..|  ::|||
Human   460 GPHSISPETTVTS---RGQAEEESPSQEETVAPGEAVQGS--VSTTG 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8924NP_573091.1 BTB 25..117 CDD:279045 25/99 (25%)
BTB 34..117 CDD:197585 22/90 (24%)
MerR 378..407 CDD:278788 8/28 (29%)
ZBTB37NP_001116242.1 BTB_POZ_ZBTB37 7..129 CDD:349531 33/144 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 140..206 15/73 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 280..344 10/66 (15%)
C2H2 Zn finger 375..395 CDD:275368 5/26 (19%)
zf-H2C2_2 387..412 CDD:404364 7/24 (29%)
zf-C2H2 401..423 CDD:395048 2/21 (10%)
C2H2 Zn finger 403..423 CDD:275368 2/19 (11%)
zf-H2C2_2 416..438 CDD:404364 6/40 (15%)
C2H2 Zn finger 431..449 CDD:275368 1/17 (6%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 457..503 13/50 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.