DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8924 and ZBTB14

DIOPT Version :9

Sequence 1:NP_573091.1 Gene:CG8924 / 32557 FlyBaseID:FBgn0030710 Length:514 Species:Drosophila melanogaster
Sequence 2:NP_001137295.1 Gene:ZBTB14 / 7541 HGNCID:12860 Length:449 Species:Homo sapiens


Alignment Length:284 Identity:56/284 - (19%)
Similarity:111/284 - (39%) Gaps:40/284 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 QLLAGQRFVDVTLACEGQQVHCHRLVLAACSTYFEAILAEHPCKHPVIILPREIKLWEIQALVDF 89
            |.|.|: |.|:.:..|..:...||.|||||||||:.:..:.......:|....::....:.::::
Human    29 QRLEGE-FCDIAIVVEDVKFRAHRCVLAACSTYFKKLFKKLEVDSSSVIEIDFLRSDIFEEVLNY 92

  Fly    90 MYKGEVNVTQAGLGQLLRCAEQLQIRGL---------YGSEAPINYKKLQQASLEAAK---DPAA 142
            ||..:::|.:..:..::...:.|.||.|         ..|....|.:...:..|:..:   |.|.
Human    93 MYTAKISVKKEDVNLMMSSGQILGIRFLDKLCSQKRDVSSPDENNGQSKSKYCLKINRPIGDAAD 157

  Fly   143 TTARSFKHVDSAETDDAATNSTTSTTMTTSSAPPLPVNHQQPT--------VLKR-QNPDARQQQ 198
            |.....:.:  .:.||:.::.|...|      ||...:.:.||        :||. .:.:.|:..
Human   158 TQDDDVEEI--GDQDDSPSDDTVEGT------PPSQEDGKSPTTTLRVQEAILKELGSEEVRKVN 214

  Fly   199 QQQQQQQVQQRPQINGSNAQQPSKATSTNVLG--SHSNAPTEDDSGDEVPNNWNAYGEQFDDCNI 261
            ...|:.:..:.|:.....:|.|...|..:.:.  .....|....:..::...:..||...:  .|
Human   215 CYGQEVESMETPESKDLGSQTPQALTFNDGMSEVKDEQTPGWTTAASDMKFEYLLYGHHRE--QI 277

  Fly   262 SAQAV------DNKMNVHLSLQQA 279
            :.||.      :.::..|..|..|
Human   278 ACQACGKTFSDEGRLRKHEKLHTA 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8924NP_573091.1 BTB 25..117 CDD:279045 24/91 (26%)
BTB 34..117 CDD:197585 20/82 (24%)
MerR 378..407 CDD:278788
ZBTB14NP_001137295.1 BTB_POZ_ZBTB14 18..131 CDD:349513 25/102 (25%)
Nuclear localization signal. /evidence=ECO:0000255 50..66 11/15 (73%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 153..194 11/48 (23%)
C2H2 Zn finger 279..299 CDD:275368 3/19 (16%)
SFP1 <303..383 CDD:227516
C2H2 Zn finger 307..327 CDD:275368
zf-H2C2_2 319..344 CDD:404364
C2H2 Zn finger 335..355 CDD:275368
C2H2 Zn finger 363..383 CDD:275368
C2H2 Zn finger 391..407 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.