DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8924 and BTBD18

DIOPT Version :9

Sequence 1:NP_573091.1 Gene:CG8924 / 32557 FlyBaseID:FBgn0030710 Length:514 Species:Drosophila melanogaster
Sequence 2:NP_001138573.1 Gene:BTBD18 / 643376 HGNCID:37214 Length:712 Species:Homo sapiens


Alignment Length:479 Identity:103/479 - (21%)
Similarity:162/479 - (33%) Gaps:121/479 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 AFPQLLAGQR---FVDVTLACEGQQVHCHRLVLAACSTYF-EAILAEHPCKHPVIILP-REIKLW 81
            ||.||...|:   |.||.|..||:.|..|..:|:|||.:| |.:..|.|.:...::|. ..:|:.
Human    20 AFLQLHHQQQSDVFCDVLLQAEGEAVPAHCCILSACSPFFTERLERERPAQGGKVVLELGGLKIS 84

  Fly    82 EIQALVDFMYKGEVNVTQAGLGQLLRCAEQLQIRGLYGSEAPINYKKLQQASLEAAKDPAATTAR 146
            .::.||||:|..|:.|:|.....:|..|.||::            .:|:...||..|...|...|
Human    85 TLRKLVDFLYTSEMEVSQEEAQDVLSAARQLRV------------SELESLQLEGGKLVKAPQGR 137

  Fly   147 SFKHVDSAETDDAATNSTTSTTMTTSSAPPLPVNHQQPTVLKRQNPDARQQQQQQQQQQVQQRPQ 211
            .... :..:...||..|....|.:.....|||.| |.|..|......:..:::..|:...|....
Human   138 RLNR-ECLQPTSAAPISARVVTPSHHPHTPLPTN-QTPCPLGAIRLKSLGKEEGPQENNRQNADN 200

  Fly   212 INGSNAQQ------PSKATSTNVLGSHSNAPTEDDSGDEVPNNWNAYGEQFDDCNISAQAVDNKM 270
            ::|:...:      |:.....:...|||..|.|           |......|...:|..::...:
Human   201 LSGTLLLKRKARACPTPQEKNSSPSSHSQEPRE-----------NKNDTALDPTVLSPPSLYPSV 254

  Fly   271 NVHLSLQQARMQMQLQQQQYLDSNVEDDHNYVAAHDENNDSSFATG---VPCGSG------LSLS 326
            :.||..::.|:...........|               ..||..:|   ||...|      .|::
Human   255 DKHLLPRKIRLSRSKPSPGICTS---------------KPSSILSGSSSVPATPGRRLWRQRSVN 304

  Fly   327 LDT-----------DLDTSANTSGGLSHSSIDGYTSYKRVRRSE--------ASLAQAAKC---- 368
            .:|           .|.::.|.||       .|.|...|.|..|        |...|..:.    
Human   305 KETPEDKPKPGRASPLQSTPNPSG-------LGKTGGSRKRSPEVRAPNSDSAEEGQVGRVKLRK 362

  Fly   369 VSKGETFQTVSNM-----------------FNIPVSTIRFYMARKGILPKRKRGRGASHAGNIII 416
            :..|..::.|...                 |..|..|..|....:.:.|.|..           :
Human   363 IVNGTCWEVVQETPLKNTQDSPQIPDPGGDFQEPSGTQPFSSNEQEMSPTRTE-----------L 416

  Fly   417 TTNS---GKLSTVPASITHPPAHP 437
            ..:|   .||..:..|.:|.|.||
Human   417 CQDSPMCTKLQDILVSASHSPDHP 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8924NP_573091.1 BTB 25..117 CDD:279045 33/96 (34%)
BTB 34..117 CDD:197585 29/84 (35%)
MerR 378..407 CDD:278788 7/45 (16%)
BTBD18NP_001138573.1 BTB 24..120 CDD:306997 32/107 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 157..176 7/19 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 212..355 31/175 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 374..410 4/35 (11%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 653..676
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 691..712
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000141
OrthoInspector 1 1.000 - - otm40394
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.