DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8924 and ab

DIOPT Version :9

Sequence 1:NP_573091.1 Gene:CG8924 / 32557 FlyBaseID:FBgn0030710 Length:514 Species:Drosophila melanogaster
Sequence 2:NP_476562.1 Gene:ab / 34560 FlyBaseID:FBgn0264442 Length:904 Species:Drosophila melanogaster


Alignment Length:416 Identity:97/416 - (23%)
Similarity:161/416 - (38%) Gaps:101/416 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 QEFCVRWNSHLGSIGAAFPQLLAGQRFVDVTLACEGQQVHCHRLVLAACSTYFEAILAEHPCKHP 70
            |.:.::||....||.::|..|...:.||||||||:.:....|::||:|||.||..:|..:||:||
  Fly    76 QHYALKWNDFQSSILSSFRHLRDEEDFVDVTLACDERSFTAHKVVLSACSPYFRRLLKANPCEHP 140

  Fly    71 VIILPREIKLWEIQALVDFMYKGEVNVTQAGLGQLLRCAEQLQIRGLYGSEAPINYKKLQQASLE 135
            ::|| |:::..:::.|:.|||.|||||:...|...|:.|..||||||........|.|...|:| 
  Fly   141 IVIL-RDVRCDDVENLLSFMYNGEVNVSHEQLPDFLKTAHLLQIRGLADVNGGYPYSKALSAAL- 203

  Fly   136 AAKDPAATTARSFKHVDSAETDDAATNSTTSTTMTTSSAPPLPVNHQQPTVLKRQNPDARQQQQQ 200
                                    :.||:.:....:||...|..|:      ...|.:|......
  Fly   204 ------------------------SHNSSNNNNNNSSSNNSLSNNN------NNNNNNAESSNHN 238

  Fly   201 QQQQQVQQRPQINGSNAQQPSKATSTNVLGSHSNAPTEDDSGDEVPNNWNAYGEQFDDCNISAQA 265
            :....:.  |....:.....|.:.|.|...||:|:.:.:.||                      :
  Fly   239 KISSYLS--PNQTSAACNNSSNSNSNNHSSSHNNSSSNNISG----------------------S 279

  Fly   266 VDNKMNVHLSLQQARMQMQLQQQQYLDSNVEDDHNYVAAHDENNDSSFATGVPCGSGLSLSLDTD 330
            :::.:|...|..|....:                         ..||.|......:.|:.::...
  Fly   280 LNSSLNSPFSAPQIPPPV-------------------------TASSAAAAAAAAASLTAAVAAA 319

  Fly   331 LDTSANTSGGLSHSSIDGYTS----YKRVRRSEA-----------SLAQAAKCVSKGETFQTVSN 380
            ...:| .|.|.|.|:..|.||    .:.::.|.|           |.|.::.....||...:..:
  Fly   320 AAATA-ASAGSSSSAASGQTSGTPAIQELKASSAASPVRNPNPNPSKASSSNHWDMGEMEGSRKS 383

  Fly   381 MFNIP----VSTIRFYMARKGILPKR 402
            ....|    :.:...:.|:.||.|:|
  Fly   384 HLTPPPQKRIKSADLFRAQHGISPER 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8924NP_573091.1 BTB 25..117 CDD:279045 41/91 (45%)
BTB 34..117 CDD:197585 38/82 (46%)
MerR 378..407 CDD:278788 6/29 (21%)
abNP_476562.1 BTB 93..189 CDD:279045 44/96 (46%)
BTB 104..189 CDD:197585 40/85 (47%)
zf-Di19 545..597 CDD:283297
C2H2 Zn finger 546..567 CDD:275371
C2H2 Zn finger 575..596 CDD:275371
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451898
Domainoid 1 1.000 59 1.000 Domainoid score I10615
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1229475at2759
OrthoFinder 1 1.000 - - FOG0000141
OrthoInspector 1 1.000 - - otm40394
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23110
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.950

Return to query results.
Submit another query.