DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8924 and ZBTB12

DIOPT Version :9

Sequence 1:NP_573091.1 Gene:CG8924 / 32557 FlyBaseID:FBgn0030710 Length:514 Species:Drosophila melanogaster
Sequence 2:NP_862825.1 Gene:ZBTB12 / 221527 HGNCID:19066 Length:459 Species:Homo sapiens


Alignment Length:520 Identity:96/520 - (18%)
Similarity:151/520 - (29%) Gaps:173/520 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 QLLAGQRFVDVTLACEGQQVHCHRLVLAACSTYFEAILAEHPCKHPVIILPREIKLWEIQALVDF 89
            ||.|.:||.|||:..:..:...|:::|||||.:.......:|.....:.|....::  :..|:..
Human    25 QLRAEERFCDVTIVADSLKFRGHKVILAACSPFLRDQFLLNPSSELQVSLMHSARI--VADLLLS 87

  Fly    90 MYKGEVNVTQAGLGQLLRCAEQLQIRGLYGS---------EAPINYKK--LQQASLEAAKDPAAT 143
            .|.|.:......:...|..|..||:..:...         |..|..|:  :.:|||         
Human    88 CYTGALEFAVRDIVNYLTAASYLQMEHVVEKCRNALSQFIEPKIGLKEDGVSEASL--------- 143

  Fly   144 TARSFKHVDSAETDDAATNSTTSTTMTTSSA------PPLPVNHQQPTVLKRQNPDARQQQQQQQ 202
                   |.|.    :||.|......|...|      ||||     |.:|:              
Human   144 -------VSSI----SATKSLLPPARTPKPAPKPPPPPPLP-----PPLLR-------------- 178

  Fly   203 QQQVQQRPQINGSNAQQPSKATSTNVLGSHSNAPTEDDSGDEVPNNWNAYGEQFDDCNISAQA-- 265
                             |.|............|..||:..||         :..|.|.:..::  
Human   179 -----------------PVKLEFPLDEDLELKAEEEDEDEDE---------DVSDICIVKVESAL 217

  Fly   266 -----------------VDNKMNVHLSLQQARMQMQLQQQQYLDSNVEDDHNYV-AAHDENNDSS 312
                             :...:..||.        :|.|.....|.|......| |.:..:.|:.
Human   218 EVAHRLKPPGGLGGGLGIGGSVGGHLG--------ELAQSSVPPSTVAPPQGVVKACYSLSEDAE 274

  Fly   313 FATGVPCGSGLSLSLDTDLDTSANTSGGLSHSSIDGYTSYKRVRRSEASLAQAA----------- 366
                   |.||.|.      .....|.|.:...::........|.:..||....           
Human   275 -------GEGLLLI------PGGRASVGATSGLVEAAAVAMAARGAGGSLGAGGSRGPLPGGFSG 326

  Fly   367 -------KCVSKGETFQTVSNMFNIPVSTIRFYM-ARKGILPKRKRGRGASHAGNIIITTN---- 419
                   ||....|.||.|..:.        |:| |:..|....:.|:..:|:.|:....|    
Human   327 GNPLKNIKCTKCPEVFQGVEKLV--------FHMRAQHFIFMCPRCGKQFNHSSNLNRHMNVHRG 383

  Fly   420 --------SGKLSTVPASITHPPAHPHIHTNPLPHTQS------QQMSMDSLHLKAGIANTSGSN 470
                    .||..|..::: |.  |.::|:...|:..|      ........|||.....|:..|
Human   384 VKSHSCGICGKCFTQKSTL-HD--HLNLHSGARPYRCSYCDVRFAHKPAIRRHLKEQHGKTTAEN 445

  Fly   471  470
            Human   446  445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8924NP_573091.1 BTB 25..117 CDD:279045 23/91 (25%)
BTB 34..117 CDD:197585 18/82 (22%)
MerR 378..407 CDD:278788 6/29 (21%)
ZBTB12NP_862825.1 BTB 23..127 CDD:306997 23/103 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 153..179 8/61 (13%)
C2H2 Zn finger 335..355 CDD:275368 7/27 (26%)
zf-C2H2 359..381 CDD:306579 4/21 (19%)
COG5048 <361..>448 CDD:227381 17/88 (19%)
C2H2 Zn finger 361..381 CDD:275368 4/19 (21%)
C2H2 Zn finger 389..409 CDD:275368 5/22 (23%)
C2H2 Zn finger 417..435 CDD:275368 2/17 (12%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.