DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8924 and ZBTB9

DIOPT Version :9

Sequence 1:NP_573091.1 Gene:CG8924 / 32557 FlyBaseID:FBgn0030710 Length:514 Species:Drosophila melanogaster
Sequence 2:NP_689948.1 Gene:ZBTB9 / 221504 HGNCID:28323 Length:473 Species:Homo sapiens


Alignment Length:275 Identity:60/275 - (21%)
Similarity:105/275 - (38%) Gaps:79/275 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SIGAAFPQ------------LLAGQRFVDVTLACEGQQVHCHRLVLAACSTYF--EAILAEHPCK 68
            :|...|||            .|.| :|.||:|..:|:::..|:.||||.|.||  :.:|.:    
Human    22 TIQIEFPQHSSSLLESLNRHRLEG-KFCDVSLLVQGRELRAHKAVLAAASPYFHDKLLLGD---- 81

  Fly    69 HPVIILPREIKLWEIQALVDFMYKGEVNVTQAGLGQLLRCAEQLQIRGLYGSEAPINYKKLQQAS 133
            .|.:.||..|:....:.|:..:|.|.:.:....|...|..|..||:           ::.:.|.|
Human    82 APRLTLPSVIEADAFEGLLQLIYSGRLRLPLDALPAHLLVASGLQM-----------WQVVDQCS 135

  Fly   134 -----LEAAKDPAATTARSFKHVDSAETDDAATNSTTSTT-------------MTTSSAPPLPVN 180
                 ||.:....:....:..|         |..||||:|             :.:|::...|.:
Human   136 EILRELETSGGGISARGGNSYH---------ALLSTTSSTGGWCIRSSPFQTPVQSSASTESPAS 191

  Fly   181 HQQPT---------VLKRQNPDARQQQQQQQQQQ-----VQQRPQ---ING----SNAQQPSKAT 224
            .:.|.         ||:.|..:..::::....:.     :.|.||   ::|    .:...|...|
Human   192 TESPVGGEGSELGEVLQIQVEEEEEEEEDDDDEDQGSATLSQTPQPQRVSGVFPRPHGPHPLPMT 256

  Fly   225 ST-NVLGSHSNAPTE 238
            :| ..|....:||.|
Human   257 ATPRKLPEGESAPLE 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8924NP_573091.1 BTB 25..117 CDD:279045 29/105 (28%)
BTB 34..117 CDD:197585 25/84 (30%)
MerR 378..407 CDD:278788
ZBTB9NP_689948.1 BTB 38..140 CDD:306997 30/117 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 177..279 17/95 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 293..376
C2H2 Zn finger 388..405 CDD:275368
C2H2 Zn finger 413..433 CDD:275368
zf-C2H2 413..433 CDD:306579
C2H2 Zn finger 440..457 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.