DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8924 and btbd18

DIOPT Version :9

Sequence 1:NP_573091.1 Gene:CG8924 / 32557 FlyBaseID:FBgn0030710 Length:514 Species:Drosophila melanogaster
Sequence 2:XP_017951392.1 Gene:btbd18 / 100498010 -ID:- Length:602 Species:Xenopus tropicalis


Alignment Length:440 Identity:85/440 - (19%)
Similarity:146/440 - (33%) Gaps:165/440 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 WNSHLGSIGAAFPQLLAGQR---FVDVTL-ACEGQQVHCHRLVLAACSTYFEAILA--------- 63
            ||..|  :...|.||...|.   |.|||| ..||:.|..|..:|||||.|...:||         
 Frog    10 WNPRL--LRTMFLQLQRQQNTGFFCDVTLQGGEGEGVSVHACLLAACSPYLAKLLASVTEVSQLD 72

  Fly    64 -----EHPCKHPVIILPREIKLWEIQALVDFMYKGEVNVTQAGLGQLLRCAEQLQI--------- 114
                 :..|...::.:| .|....:..||.:||..|:.||...:..:|..|.:|||         
 Frog    73 TDSAIQTDCTGHILTVP-GIPSCYLLPLVHYMYTSELEVTPENVHGVLEAARRLQIPELEGLRLE 136

  Fly   115 --------------RGLYGS-------------------------EAPINYK------------- 127
                          |..:||                         ..|:...             
 Frog   137 GGRLVRPELARKLNRDCFGSVISQYATESGNGKQIFTKEEITSGRNVPVRMHEQGPCILEKRTNK 201

  Fly   128 --------------KLQQAS----------LEAAKDPA-----ATTARSFK--------HVDSAE 155
                          |::.:|          ||..|:|.     :|....|:        ..||..
 Frog   202 EHTFPADTGSLLRGKMEASSSLQGNIENPLLEITKNPTEKSGPSTVQTCFQSRENYECAFQDSGT 266

  Fly   156 TDD-AATNSTTSTTMTTSSAPPLPVN-----------HQQPTVLKRQNPDARQQQQQQQQQQVQQ 208
            |.: :|.|.....|..:|..|.:.:|           |...||     |..:...|.::..::|:
 Frog   267 TQNVSAINQDIEMTKLSSEIPLIVLNPDQKRHILVSEHGADTV-----PSRKTDMQDKKLFKLQR 326

  Fly   209 RPQINGSNAQQPSKATSTNVL----------GSHSNAPTEDDSGDEVPNNWNAYGEQFDDCNISA 263
            ..::.....:|.:|. .||::          |...:.|..|::   :.||:........:.|::.
 Frog   327 AYKVRKETGEQATKG-KTNIIPLSRIIKLDRGEKQDMPQMDEN---IKNNFKHKQNHNMNSNLNP 387

  Fly   264 Q---------AVDNKMNVHLSLQ------QARMQMQLQQQQYLDSNVEDD 298
            |         ..:::..:.|.|.      |:.:|:..:||:.:.|::|::
 Frog   388 QDSVLKQVCRNKNSQCTIKLELNDPSIQTQSHIQVCPEQQRIVQSHLEEN 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8924NP_573091.1 BTB 25..117 CDD:279045 36/132 (27%)
BTB 34..117 CDD:197585 32/120 (27%)
MerR 378..407 CDD:278788
btbd18XP_017951392.1 BTB_POZ_BTBD18 17..148 CDD:349602 36/131 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000141
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.