DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8924 and Btbd18

DIOPT Version :9

Sequence 1:NP_573091.1 Gene:CG8924 / 32557 FlyBaseID:FBgn0030710 Length:514 Species:Drosophila melanogaster
Sequence 2:NP_001138572.1 Gene:Btbd18 / 100270744 MGIID:3650217 Length:723 Species:Mus musculus


Alignment Length:231 Identity:60/231 - (25%)
Similarity:97/231 - (41%) Gaps:39/231 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 AFPQLLAGQR---FVDVTLACEGQQVHCHRLVLAACSTYF-EAILAEHPCKHPVIILPR-EIKLW 81
            ||.||...|:   |.|..|..||:.|..|..:|:|||.:| |.:..|.|.:...::|.. .:|:.
Mouse    20 AFLQLHHQQQSGVFCDALLQAEGEAVPAHCCILSACSPFFTERLERERPVQGRKVVLEMGGLKIQ 84

  Fly    82 EIQALVDFMYKGEVNVTQAGLGQLLRCAEQLQIRGLYGSEAPINYKKLQQASLEAAKDPAATTAR 146
            .::.||||:|..|:.|:|.....:|..|.||::            .:|:...||..|...|...|
Mouse    85 TLRKLVDFLYTSEMEVSQEEAQDVLSAARQLRV------------SELETLQLEGGKLVKAPQGR 137

  Fly   147 SFKHVDSAETDDAATNSTTSTTMTTSSAPPLPVNHQQPTVL---------------KRQN-PDAR 195
            .... :..:...||..|.......:....||||. |.|:.|               |:.| |:|.
Mouse   138 RLNR-ECLQPPAAAPISARVVGPKSRPQTPLPVT-QTPSPLGAVRLKSLGEEEGAHKKTNLPNAD 200

  Fly   196 QQQQQQQQQQVQ----QRPQINGSNAQQPSKATSTN 227
            .....|.:::.:    |..:.:.|:.::..|.|.:|
Mouse   201 SLSDTQLKKKARVCLTQESRSSPSSQREGPKETKSN 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8924NP_573091.1 BTB 25..117 CDD:279045 32/96 (33%)
BTB 34..117 CDD:197585 28/84 (33%)
MerR 378..407 CDD:278788
Btbd18NP_001138572.1 BTB_POZ_BTBD18 20..138 CDD:349602 39/129 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 150..176 8/26 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 188..350 10/49 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 370..394
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 603..637
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 699..723
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000141
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.