DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Stim and SYCP1

DIOPT Version :9

Sequence 1:NP_523357.2 Gene:Stim / 32556 FlyBaseID:FBgn0045073 Length:570 Species:Drosophila melanogaster
Sequence 2:NP_001269470.1 Gene:SYCP1 / 6847 HGNCID:11487 Length:976 Species:Homo sapiens


Alignment Length:545 Identity:114/545 - (20%)
Similarity:207/545 - (37%) Gaps:153/545 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 YSGSVQDRFGMEAIASLHRQLDDDDNGNIDLS----ESDD---FLREELKYDS-----GYEKR-- 184
            |...:.|:  .:.::.|..|:.:.:|...||:    ||.|   .|.|:.|..|     ..||:  
Human   257 YKKEINDK--EKQVSLLLIQITEKENKMKDLTFLLEESRDKVNQLEEKTKLQSENLKQSIEKQHH 319

  Fly   185 ------------------QKAFHFNDDMHISVKELWEAWLRSE-----------VHNWTI---EQ 217
                              |||  ..:|:.|:.|.:.:.....|           .|::.:   |.
Human   320 LTKELEDIKVSLQRSVSTQKA--LEEDLQIATKTICQLTEEKETQMEESNKARAAHSFVVTEFET 382

  Fly   218 TTDWLAQSVQLPQY--------------------VDLFKLHKVTGAALPRLAVNN----LQYVGN 258
            |...|.:.::..|.                    .:|.::.|:|         ||    |:.:..
Human   383 TVCSLEELLRTEQQRLEKNEDQLKILTMELQKKSSELEEMTKLT---------NNKEVELEELKK 438

  Fly   259 VLGIKDPI---HKQ--KIS--LKAMDVVLFGPPRETGTRWKDYILVTLLLSAIIGCWYAYQ---- 312
            |||.|:.:   :||  ||:  ||..:..|.|..:   .|.|:...:.:.|:||......|.    
Human   439 VLGEKETLLYENKQFEKIAEELKGTEQELIGLLQ---AREKEVHDLEIQLTAITTSEQYYSKEVK 500

  Fly   313 ------QNKNAKR-----HLRRMAQDMEGLQRAEQSLQEMQKELERARMEQENVATEKLDLERRL 366
                  :|:..|.     |..:::.:.:.|   .|...:|..||:.   :||::...|...||.|
Human   501 DLKTELENEKLKNTELTSHCNKLSLENKEL---TQETSDMTLELKN---QQEDINNNKKQEERML 559

  Fly   367 KEAPTLSSSNSDLEVQQLKKEIEMLRNELSRAEFEL-------VDNCWSPPPQLQSWLQYTYELE 424
            |:...|..:.:     ||:.|:|.:|.||.:...|:       .:||.:...|:::..:|..||:
Human   560 KQIENLQETET-----QLRNELEYVREELKQKRDEVKCKLDKSEENCNNLRKQVENKNKYIEELQ 619

  Fly   425 SKNH--QKKRTSAEKQLQSAREACEKLRKKRSSL---VGAFVSTHGKSIDDVDRS------IVEA 478
            .:|.  :||.|:..|||........||..:..|.   .|....|:.|.|:|...|      .||.
Human   620 QENKALKKKGTAESKQLNVYEIKVNKLELELESAKQKFGEITDTYQKEIEDKKISEENLLEEVEK 684

  Fly   479 RNALGDVTNELQERLHRWKQIETCLGLNIVNNNGLPYLENVLYGRNGGLQSSMGMSSTKGSRARI 543
            ...:.|...:||:.:.:..|.:....:.::..:...| :.::..|:    |.:|:..:|      
Human   685 AKVIADEAVKLQKEIDKRCQHKIAEMVALMEKHKHQY-DKIIEERD----SELGLYKSK------ 738

  Fly   544 TNSTEDLDDESIQGKLNFENFSLLA 568
                 :.:..|::..|..|..:|.|
Human   739 -----EQEQSSLRASLEIELSNLKA 758

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
StimNP_523357.2 SAM_STIM-1,2-like 209..282 CDD:188903 23/117 (20%)
SAM 210..271 CDD:197735 17/92 (18%)
GBP_C <312..392 CDD:303769 20/94 (21%)
coiled coil 360..372 CDD:293879 4/11 (36%)
coiled coil 381..392 CDD:293879 4/10 (40%)
SOAR 410..507 CDD:293141 26/107 (24%)
SYCP1NP_001269470.1 SCP-1 28..792 CDD:114219 114/545 (21%)
Mediates head to head self-assembly of N-terminal ends. /evidence=ECO:0000269|PubMed:29915389 101..111
Nuclear localization signal. /evidence=ECO:0000255 117..120
Required for pH-induced assembly of C-terminal ends into antiparallel tetramers. /evidence=ECO:0000269|PubMed:29915389 676..770 16/99 (16%)
Nuclear localization signal. /evidence=ECO:0000255 679..682 0/2 (0%)
DNA-binding. /evidence=ECO:0000269|PubMed:29915389 784..976
Nuclear localization signal. /evidence=ECO:0000255 880..883
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.