| Sequence 1: | NP_996469.1 | Gene: | Lcch3 / 32554 | FlyBaseID: | FBgn0010240 | Length: | 496 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001023767.1 | Gene: | srsx-31 / 3565162 | WormBaseID: | WBGene00008552 | Length: | 308 | Species: | Caenorhabditis elegans |
| Alignment Length: | 265 | Identity: | 48/265 - (18%) |
|---|---|---|---|
| Similarity: | 89/265 - (33%) | Gaps: | 100/265 - (37%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 117 ISDVLTLSGDFAEKIWVPDTFFANDKNS-------FLHDV----TERNKLVRLGGD--------- 161
Fly 162 --------GAVTYGMR--FTTTLACMMDLHYYPLDSQN----CTVEI----ESYGY--------T 200
Fly 201 VSDVVMYWKPTPVRGVEDAELPQFTIIGYETNDRKERLATGVYQRLSLSFKLQRNIGYFVFQTYL 265
Fly 266 PSILIVMLSWVSFWINH-------------EATSARVALGIT-----TVLTMTTISTGVRSSLPR 312
Fly 313 ISYVK 317 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Lcch3 | NP_996469.1 | LIC | 15..493 | CDD:273305 | 48/265 (18%) |
| Neur_chan_LBD | 47..256 | CDD:280998 | 33/184 (18%) | ||
| Neur_chan_memb | 263..490 | CDD:280999 | 12/73 (16%) | ||
| srsx-31 | NP_001023767.1 | TM helix 1 | 11..36 | CDD:341315 | |
| 7TM_GPCR_Srsx | 19..277 | CDD:255903 | 47/260 (18%) | ||
| TM helix 2 | 43..67 | CDD:341315 | 4/18 (22%) | ||
| TM helix 3 | 79..109 | CDD:341315 | 5/29 (17%) | ||
| TM helix 4 | 122..140 | CDD:341315 | 4/17 (24%) | ||
| TM helix 5 | 165..190 | CDD:341315 | 5/36 (14%) | ||
| TM helix 6 | 201..230 | CDD:341315 | 5/28 (18%) | ||
| TM helix 7 | 241..266 | CDD:341315 | 4/24 (17%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3644 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||