DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcch3 and GABRG1

DIOPT Version :9

Sequence 1:NP_996469.1 Gene:Lcch3 / 32554 FlyBaseID:FBgn0010240 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_775807.2 Gene:GABRG1 / 2565 HGNCID:4086 Length:465 Species:Homo sapiens


Alignment Length:512 Identity:176/512 - (34%)
Similarity:250/512 - (48%) Gaps:101/512 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LFFFLLGAQLQLIRCIRKD--------------VLAGRLE--NVTQTISNILQGYDIRLRPNFGG 61
            |.|.||  .|.|..|:.|.              |||.::.  ::||.::::|||||.:|||:.|.
Human    23 LVFLLL--TLHLGNCVDKADDEDDEDLTVNKTWVLAPKIHEGDITQILNSLLQGYDNKLRPDIGV 85

  Fly    62 EPLHVGMDLTIASFDAISEVNMDYTITMYLNQYWRDERLAFNIFGQYFDDENDDGISDVLTLSGD 126
            .|..:..|:.:.|...:..:||:|||.:...|.|.|.||.||            ....||.|:.:
Human    86 RPTVIETDVYVNSIGPVDPINMEYTIDIIFAQTWFDSRLKFN------------STMKVLMLNSN 138

  Fly   127 FAEKIWVPDTFFANDKNSFLHDVTERNKLVRLGGDGAVTYGMRFTTTLACMMDLHYYPLDSQNCT 191
            ...|||:|||||.|.:.|..|.:|..|:|:|:..||.|.|.:|.|....|.:.||.:|:|..:|.
Human   139 MVGKIWIPDTFFRNSRKSDAHWITTPNRLLRIWNDGRVLYTLRLTINAECYLQLHNFPMDEHSCP 203

  Fly   192 VEIESYGYTVSDVVMYWKPTPVRGVEDAE---LPQFTIIGYETNDRKERLATGVYQRLSLSFKLQ 253
            :|..||||..:::...||...|. |.|.:   |.||..:|...:.......:|.|..:::.|.|.
Human   204 LEFSSYGYPKNEIEYKWKKPSVE-VADPKYWRLYQFAFVGLRNSTEITHTISGDYVIMTIFFDLS 267

  Fly   254 RNIGYFVFQTYLPSILIVMLSWVSFWINHEATSARVALGITTVLTMTTISTGVRSSLPRISYVKA 318
            |.:|||..|||:|.||.|:|||||||||.:|..||.:|||||||||||:||..|.|||::|||.|
Human   268 RRMGYFTIQTYIPCILTVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTIARKSLPKVSYVTA 332

  Fly   319 IDIYLVMCFVFVFAALLEYAAVNY---TYWGKRAKK--KIKKVKECCPGKIGKSERSETCSTTED 378
            :|:::.:||:||||||:||..::|   ...||.|.|  |:|......||          ......
Human   333 MDLFVSVCFIFVFAALMEYGTLHYFTSNQKGKTATKDRKLKNKASMTPG----------LHPGST 387

  Fly   379 IIELQDVRMSPIPSLRRGTYNATLDSIGTETMNLGKFPPSFRI------TRNYGTGHSQLRRRAQ 437
            :|.:.::   .:|.         .|..|.:.:. ||...||..      |.::..|...:|    
Human   388 LIPMNNI---SVPQ---------EDDYGYQCLE-GKDCASFFCCFEDCRTGSWREGRIHIR---- 435

  Fly   438 RGISTRPRMLHALKRGASAIKATIPKIKDVNIIDKYSRMIFPISFLAFNLGYWLFYI 494
                                   |.|      ||.|||:.||.:|..|||.||:.|:
Human   436 -----------------------IAK------IDSYSRIFFPTAFALFNLVYWVGYL 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcch3NP_996469.1 LIC 15..493 CDD:273305 174/507 (34%)
Neur_chan_LBD 47..256 CDD:280998 73/211 (35%)
Neur_chan_memb 263..490 CDD:280999 83/237 (35%)
GABRG1NP_775807.2 LIC 66..462 CDD:273305 163/464 (35%)
LGIC_ECD_GABAAR_G 88..269 CDD:349801 62/193 (32%)
Cys-loop 188..202 CDD:349801 5/13 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3644
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.