DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcch3 and GABRA6

DIOPT Version :9

Sequence 1:NP_996469.1 Gene:Lcch3 / 32554 FlyBaseID:FBgn0010240 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_000802.2 Gene:GABRA6 / 2559 HGNCID:4080 Length:453 Species:Homo sapiens


Alignment Length:461 Identity:161/461 - (34%)
Similarity:244/461 - (52%) Gaps:53/461 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 ENVTQTISNILQGYDIRLRPNFGGEPLHVGMDLTIASFDAISEVNMDYTITMYLNQYWRDERLAF 102
            |||::.:.|:|:|||.||||.|||....|..|:.:.||..:|:|.|:||:.::..|.|.||||.|
Human    30 ENVSRILDNLLEGYDNRLRPGFGGAVTEVKTDIYVTSFGPVSDVEMEYTMDVFFRQTWTDERLKF 94

  Fly   103 NIFGQYFDDENDDGISDVLTLSGDFAEKIWVPDTFFANDKNSFLHDVTERNKLVRLGGDGAVTYG 167
            .            |.:::|:|:.....|||.|||||.|.|.|..|::|..|||.|:..:|.:.|.
Human    95 G------------GPTEILSLNNLMVSKIWTPDTFFRNGKKSIAHNMTTPNKLFRIMQNGTILYT 147

  Fly   168 MRFTTTLACMMDLHYYPLDSQNCTVEIESYGYTVSDVVMYWKPTPVRGV----EDAELPQFTIIG 228
            ||.|....|.|.|..:|:|...|.::..||.|..|:::..||..|:..|    |.:.|.|:.:||
Human   148 MRLTINADCPMRLVNFPMDGHACPLKFGSYAYPKSEIIYTWKKGPLYSVEVPEESSSLLQYDLIG 212

  Fly   229 YETNDRKERLATGVYQRLSLSFKLQRNIGYFVFQTYLPSILIVMLSWVSFWINHEATSARVALGI 293
            ...:....:..||.|..:::.|.|||.:|||:.|.|.|.|:.|:||.||||||.|:..||...||
Human   213 QTVSSETIKSNTGEYVIMTVYFHLQRKMGYFMIQIYTPCIMTVILSQVSFWINKESVPARTVFGI 277

  Fly   294 TTVLTMTTISTGVRSSLPRISYVKAIDIYLVMCFVFVFAALLEYAAVNYTYWGKRAKKKIKKVKE 358
            ||||||||:|...|.|||::||..|:|.::.:||.|||:||:|:||||| :...:.:|..:|.:.
Human   278 TTVLTMTTLSISARHSLPKVSYATAMDWFIAVCFAFVFSALIEFAAVNY-FTNLQTQKAKRKAQF 341

  Fly   359 CCPGKIGKSERSETCSTTEDIIELQDVRMSPIPSLRRGTYNATLDSIGTETMNLGKFPPSFRITR 423
            ..|..:..|:.:|....  :|:...|.:.    .|::...:.:|..:.:...|            
Human   342 AAPPTVTISKATEPLEA--EIVLHPDSKY----HLKKRITSLSLPIVSSSEAN------------ 388

  Fly   424 NYGTGHSQLRRRAQRGISTRPRMLHALKRGASAIKATIPKIKDVNIIDKYSRMIFPISFLAFNLG 488
                           .:.||..:|.:.......:.   |.....:.||:|||::||::|..|||.
Human   389 ---------------KVLTRAPILQSTPVTPPPLS---PAFGGTSKIDQYSRILFPVAFAGFNLV 435

  Fly   489 YWLFYI 494
            ||:.|:
Human   436 YWVVYL 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcch3NP_996469.1 LIC 15..493 CDD:273305 160/458 (35%)
Neur_chan_LBD 47..256 CDD:280998 78/212 (37%)
Neur_chan_memb 263..490 CDD:280999 72/226 (32%)
GABRA6NP_000802.2 Neur_chan_LBD 5..440 CDD:332142 160/458 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3644
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.