DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcch3 and GABRA5

DIOPT Version :9

Sequence 1:NP_996469.1 Gene:Lcch3 / 32554 FlyBaseID:FBgn0010240 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_000801.1 Gene:GABRA5 / 2558 HGNCID:4079 Length:462 Species:Homo sapiens


Alignment Length:482 Identity:168/482 - (34%)
Similarity:237/482 - (49%) Gaps:88/482 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 KDVLAGRLENVTQTISNILQGYDIRLRPNFGGEPLHVGMDLTIASFDAISEVNMDYTITMYLNQY 94
            ||.....:...|:.:..:|.|||.||||..|.....|..|:.:.||..:|:..|:|||.::..|.
Human    39 KDETNDNITIFTRILDGLLDGYDNRLRPGLGERITQVRTDIYVTSFGPVSDTEMEYTIDVFFRQS 103

  Fly    95 WRDERLAFNIFGQYFDDENDDGISDVLTLSGDFAEKIWVPDTFFANDKNSFLHDVTERNKLVRLG 159
            |:||||.|.            |....|.|:...|.|||.|||||.|.|.|..|::|..|||:||.
Human   104 WKDERLRFK------------GPMQRLPLNNLLASKIWTPDTFFHNGKKSIAHNMTTPNKLLRLE 156

  Fly   160 GDGAVTYGMRFTTTLACMMDLHYYPLDSQNCTVEIESYGYTVSDVVMYWKPTPVRGVEDAE---- 220
            .||.:.|.||.|.:..|.|.|..:|:|:..|.::..||.|..|:||..|.....:.|..||    
Human   157 DDGTLLYTMRLTISAECPMQLEDFPMDAHACPLKFGSYAYPNSEVVYVWTNGSTKSVVVAEDGSR 221

  Fly   221 LPQFTIIGYETNDRKERLATGVYQRLSLSFKLQRNIGYFVFQTYLPSILIVMLSWVSFWINHEAT 285
            |.|:.::|..........:||.|..::..|.|:|.|||||.|||||.|:.|:||.||||:|.|:.
Human   222 LNQYHLMGQTVGTENISTSTGEYTIMTAHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESV 286

  Fly   286 SARVALGITTVLTMTTISTGVRSSLPRISYVKAIDIYLVMCFVFVFAALLEYAAVNY------TY 344
            .||...|:||||||||:|...|:|||:::|..|:|.::.:|:.|||:||:|:|.|||      .:
Human   287 PARTVFGVTTVLTMTTLSISARNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGWAW 351

  Fly   345 WGKRAKK--KIKKVKECCPGKIGKSERSETCSTTEDIIELQDVRMSPIPSLRR-----GTYNATL 402
            .||:|.:  ||||.:|..   :.||..:.|..           :||..|::.:     ||.|.| 
Human   352 DGKKALEAAKIKKKREVI---LNKSTNAFTTG-----------KMSHPPNIPKEQTPAGTSNTT- 401

  Fly   403 DSIGTETMNLGKFPPSFRITRNYGTGHSQLRRRAQRGISTRPRMLHALKRGASAIKATIPKIKDV 467
                                                .:|.:|.     :...|..|.|   ...:
Human   402 ------------------------------------SVSVKPS-----EEKTSESKKT---YNSI 422

  Fly   468 NIIDKYSRMIFPISFLAFNLGYWLFYI 494
            :.|||.||::||:.|..|||.||..|:
Human   423 SKIDKMSRIVFPVLFGTFNLVYWATYL 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcch3NP_996469.1 LIC 15..493 CDD:273305 167/479 (35%)
Neur_chan_LBD 47..256 CDD:280998 78/212 (37%)
Neur_chan_memb 263..490 CDD:280999 78/239 (33%)
GABRA5NP_000801.1 LGIC_ECD_GABAAR_A5 58..256 CDD:349839 76/209 (36%)
LGIC_TM_GABAAR_alpha 259..445 CDD:349854 82/244 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 377..412 10/87 (11%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3644
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.