DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcch3 and GABRA3

DIOPT Version :9

Sequence 1:NP_996469.1 Gene:Lcch3 / 32554 FlyBaseID:FBgn0010240 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_000799.1 Gene:GABRA3 / 2556 HGNCID:4077 Length:492 Species:Homo sapiens


Alignment Length:482 Identity:172/482 - (35%)
Similarity:248/482 - (51%) Gaps:75/482 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 DVLAGRLENV---TQTISNILQGYDIRLRPNFGGEPLHVGMDLTIASFDAISEVNMDYTITMYLN 92
            |:.....:|:   |:.:..:|.|||.||||..|.....|..|:.:.||..:|:.:|:|||.::..
Human    55 DIPDDSTDNITIFTRILDRLLDGYDNRLRPGLGDAVTEVKTDIYVTSFGPVSDTDMEYTIDVFFR 119

  Fly    93 QYWRDERLAFNIFGQYFDDENDDGISDVLTLSGDFAEKIWVPDTFFANDKNSFLHDVTERNKLVR 157
            |.|.||||.|            ||...:|.|:...|.|||.|||||.|.|.|..|::|..|||:|
Human   120 QTWHDERLKF------------DGPMKILPLNNLLASKIWTPDTFFHNGKKSVAHNMTTPNKLLR 172

  Fly   158 LGGDGAVTYGMRFTTTLACMMDLHYYPLDSQNCTVEIESYGYTVSDVVMYWKPTPVRGVEDAE-- 220
            |..:|.:.|.||.|....|.|.|..:|:|...|.::..||.||.::||..|.....:.||.|:  
Human   173 LVDNGTLLYTMRLTIHAECPMHLEDFPMDVHACPLKFGSYAYTTAEVVYSWTLGKNKSVEVAQDG 237

  Fly   221 --LPQFTIIGYETNDRKERLATGVYQRLSLSFKLQRNIGYFVFQTYLPSILIVMLSWVSFWINHE 283
              |.|:.::|:.......|.:||.|..::..|.|:|.|||||.|||||.|:.|:||.||||:|.|
Human   238 SRLNQYDLLGHVVGTEIIRSSTGEYVVMTTHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRE 302

  Fly   284 ATSARVALGITTVLTMTTISTGVRSSLPRISYVKAIDIYLVMCFVFVFAALLEYAAVNY---TYW 345
            :..||...|:||||||||:|...|:|||:::|..|:|.::.:|:.|||:||:|:|.|||   ..|
Human   303 SVPARTVFGVTTVLTMTTLSISARNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRSW 367

  Fly   346 GKRAKK-----KIKKVKECCPGKIGKSERSETCSTTEDIIELQDVRMSPIPSLRRGTYNATLDSI 405
            ....||     ::||.....|.|        ..|||.:|:               ||        
Human   368 AWEGKKVPEALEMKKKTPAAPAK--------KTSTTFNIV---------------GT-------- 401

  Fly   406 GTETMNLGKFPPSFRITRNYGTGHSQLRRRAQRGISTRPRMLHALKRGASAIKATIPKIK---DV 467
             |..:||.|           .|..|.:.:.|....|:.|.::.:.|  |:.::.:..:.|   .|
Human   402 -TYPINLAK-----------DTEFSTISKGAAPSASSTPTIIASPK--ATYVQDSPTETKTYNSV 452

  Fly   468 NIIDKYSRMIFPISFLAFNLGYWLFYI 494
            :.:||.||:|||:.|..|||.||..|:
Human   453 SKVDKISRIIFPVLFAIFNLVYWATYV 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcch3NP_996469.1 LIC 15..493 CDD:273305 171/479 (36%)
Neur_chan_LBD 47..256 CDD:280998 79/212 (37%)
Neur_chan_memb 263..490 CDD:280999 81/237 (34%)
GABRA3NP_000799.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 28..54
LIC 69..478 CDD:273305 168/465 (36%)
LGIC_ECD_GABAAR_A3 75..274 CDD:349837 78/210 (37%)
Cys-loop 191..205 CDD:349837 5/13 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3644
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.