DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcch3 and lgc-32

DIOPT Version :9

Sequence 1:NP_996469.1 Gene:Lcch3 / 32554 FlyBaseID:FBgn0010240 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_508139.2 Gene:lgc-32 / 188603 WormBaseID:WBGene00020569 Length:390 Species:Caenorhabditis elegans


Alignment Length:264 Identity:48/264 - (18%)
Similarity:102/264 - (38%) Gaps:55/264 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 WVPDTFFANDKNSFLHDVTERNKL--VRLGGDGAVTYGMRFTTTLACMMDLHYYPLDSQNCTVEI 194
            |:|..:|     .|.:::.|...|  :.:...|.:|...|...::.|......:|..:..||:  
 Worm    99 WLPHVYF-----PFSYNLEESRNLYNIEIHESGNITLSKRLKQSIPCKEQSDSHPFSNNTCTL-- 156

  Fly   195 ESYGYTVSD----VVMYWKPTPVR-GVEDAELPQFTI--IGYETNDRKERLATGVYQRLSLSFKL 252
             |:.||..|    :|:  :|:.:. .||.....||.:  :.:|::...|       ||  |.:.:
 Worm   157 -SWKYTNLDNYQKIVI--EPSNLMDSVEREHSRQFILKDVTFESSGDDE-------QR--LHYTI 209

  Fly   253 QRNIGYFVFQTYLPSILIVMLSWVSFWINHEATSARVALGITTVLTMTTISTGVRSSLPRISYVK 317
            .:...|.:...:.|::|.::..|:|..:...|.:..:.|..:.:|........| :..|..:.:.
 Worm   210 TQTPQYLLLHFFFPALLFLIPPWLSLLLGPMAITRCIILMTSLILLSNHYDRNV-TVFPIDASLN 273

  Fly   318 AIDIYLVMCFVFVFAALLEYAAVN--------------------------YTYWGKRAKKKIKKV 356
            ||.|:.:..:::|...::|...:.                          |.......::|.:|.
 Worm   274 AISIWQLFTYIYVIGIVIELIIITLFASMGRSKTCCFAKRRSAKYEMEPLYEEMNDLRQRKTRKT 338

  Fly   357 KECC 360
            :.||
 Worm   339 RNCC 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcch3NP_996469.1 LIC 15..493 CDD:273305 48/264 (18%)
Neur_chan_LBD 47..256 CDD:280998 28/132 (21%)
Neur_chan_memb 263..490 CDD:280999 19/124 (15%)
lgc-32NP_508139.2 LIC 61..>286 CDD:273305 41/206 (20%)
LGIC_ECD 61..>162 CDD:355788 15/70 (21%)
Cys-loop 140..154 CDD:349787 2/13 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3644
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.