DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcch3 and AgaP_AGAP012975

DIOPT Version :9

Sequence 1:NP_996469.1 Gene:Lcch3 / 32554 FlyBaseID:FBgn0010240 Length:496 Species:Drosophila melanogaster
Sequence 2:XP_003436941.1 Gene:AgaP_AGAP012975 / 11175937 VectorBaseID:AGAP012975 Length:210 Species:Anopheles gambiae


Alignment Length:195 Identity:63/195 - (32%)
Similarity:93/195 - (47%) Gaps:22/195 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 TISNIL----QGYDIRLRPNFGGEPLHVGMDLTIASFDAISEVNMDYTITMYLNQYWRDERLAF- 102
            ::|:||    :.||....|...|:|..|...:|:.|.|:|:|.:|.|...::|.|.|||.||.. 
Mosquito    17 SLSDILPTHQKTYDKNRAPKLLGQPTVVYFHVTVLSIDSINEESMTYVADIFLAQSWRDPRLRLP 81

  Fly   103 -NIFGQYFDDENDDGISDVLTLSGDFAEKIWVPDTFFANDKNSFLHDVTERNKLVRLGGDGAVTY 166
             |:..:|       .|.||     |:...||.||.||.|.|....|:::..|..:.|..|..:.|
Mosquito    82 ENMSEEY-------RILDV-----DWLHSIWRPDCFFKNAKKVTFHEMSIPNHYLWLYHDKTLLY 134

  Fly   167 GMRFTTTLACMMDLHYYPLDSQNCTVEIES--YG-YTVSDVVMYWKPTPVRGVEDAELPQFTIIG 228
            ..:.|..|:|.|....||.|:|.|::.|||  || |......:.||....:.:.: |||:....|
Mosquito   135 MSKLTLVLSCAMKFESYPHDTQICSMMIESCKYGQYQGKGCRVVWKKLQRKKLAE-ELPEVWFFG 198

  Fly   229  228
            Mosquito   199  198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcch3NP_996469.1 LIC 15..493 CDD:273305 63/195 (32%)
Neur_chan_LBD 47..256 CDD:280998 62/191 (32%)
Neur_chan_memb 263..490 CDD:280999
AgaP_AGAP012975XP_003436941.1 Neur_chan_LBD 29..208 CDD:280998 60/183 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3644
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.