DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcch3 and LOC101883326

DIOPT Version :9

Sequence 1:NP_996469.1 Gene:Lcch3 / 32554 FlyBaseID:FBgn0010240 Length:496 Species:Drosophila melanogaster
Sequence 2:XP_021324924.1 Gene:LOC101883326 / 101883326 -ID:- Length:358 Species:Danio rerio


Alignment Length:352 Identity:151/352 - (42%)
Similarity:197/352 - (55%) Gaps:52/352 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 CTVEIESYGYTVSDVVMYWK--PTPVRGVEDAELPQFTIIGYETNDRKERLATGVYQRLSLSFKL 252
            |...:.|.|||..|:..||:  ...|.|||..|||||:|:.|:...:....:||.|.||||||||
Zfish    11 CVCSLLSDGYTTDDIEFYWRGGNHAVTGVERIELPQFSIVDYKLISKNVVFSTGSYPRLSLSFKL 75

  Fly   253 QRNIGYFVFQTYLPSILIVMLSWVSFWINHEATSARVALGITTVLTMTTISTGVRSSLPRISYVK 317
            :||||||:.|||:|||||.:|||||||||::|::||||||||||||||||:|.:|.:||:|.|||
Zfish    76 KRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVK 140

  Fly   318 AIDIYLVMCFVFVFAALLEYAAVNYTYWGK----------RAKKKIKKVKECCPGK--IGKSERS 370
            |||:||:.||||||.||||||.|||.::|:          ||.|...:.....|.|  :|...:.
Zfish   141 AIDMYLMGCFVFVFLALLEYALVNYIFFGRGPQQQKKAAERASKANNEKMRMDPNKWLVGNVVQR 205

  Fly   371 ET---CSTTEDIIELQDVRMSPI----PSLRRGTYNATLD--------------SIGTETMNLGK 414
            :.   ....:..|:..|....||    .:|..|.....:|              .:||..:.||.
Zfish   206 DDGLYARMKQRDIDAHDSMWEPIFVDDAALGLGDSKNKMDPHENILLTPLEIKNEMGTSELTLGL 270

  Fly   415 FPPSFRIT-----------RNYGTGHSQLRRRA-QRGISTRPRMLHALKRGASAIKATIPKIKDV 467
            ..|  |.|           |..|.......|.| :|.::.:.   ..|:|.||.:|.|||.:.||
Zfish   271 GDP--RATMLAYDSTTLQYRKAGLARHNFGRNALERHVAQKK---SRLRRRASQLKITIPDLTDV 330

  Fly   468 NIIDKYSRMIFPISFLAFNLGYWLFYI 494
            |.|||:||||||..|..||:.|||:|:
Zfish   331 NSIDKWSRMIFPTVFSFFNVVYWLYYV 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcch3NP_996469.1 LIC 15..493 CDD:273305 150/349 (43%)
Neur_chan_LBD 47..256 CDD:280998 31/67 (46%)
Neur_chan_memb 263..490 CDD:280999 110/271 (41%)
LOC101883326XP_021324924.1 Neur_chan_LBD <8..356 CDD:332142 150/349 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D226476at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.