DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcch3 and LOC100001259

DIOPT Version :9

Sequence 1:NP_996469.1 Gene:Lcch3 / 32554 FlyBaseID:FBgn0010240 Length:496 Species:Drosophila melanogaster
Sequence 2:XP_021336767.1 Gene:LOC100001259 / 100001259 -ID:- Length:369 Species:Danio rerio


Alignment Length:325 Identity:130/325 - (40%)
Similarity:187/325 - (57%) Gaps:20/325 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 RCIRKDVLAGRLEN----VTQTISNILQGYDIRLRPNFGGEPLHVGMDLTIASFDAISEVNMDYT 86
            |.:..|......:|    .|:.:..:|.|||.||||..|.....|..|:.:.||..:|:.:|:||
Zfish    21 RSVSADATTDAFKNNITLFTRILDRLLDGYDNRLRPGLGDRVTTVKTDIYVTSFGPVSDTDMEYT 85

  Fly    87 ITMYLNQYWRDERLAFNIFGQYFDDENDDGISDVLTLSGDFAEKIWVPDTFFANDKNSFLHDVTE 151
            |.::..|.|:||||.|            :|..::|.|:...|.|||.|||||.|.|.|..|::|.
Zfish    86 IDVFFRQSWKDERLKF------------EGPMNILRLNNLMASKIWTPDTFFHNGKKSVAHNMTM 138

  Fly   152 RNKLVRLGGDGAVTYGMRFTTTLACMMDLHYYPLDSQNCTVEIESYGYTVSDVVMYWKPTPVRGV 216
            .|||:|:..||.:.|.||.|....|.|.|..:|:|..:|.::..||.||.::|...|.......|
Zfish   139 PNKLLRIQDDGTLLYTMRLTVHAECPMHLEDFPMDFHSCPLKFGSYAYTTTEVTYTWTKNASNSV 203

  Fly   217 ----EDAELPQFTIIGYETNDRKERLATGVYQRLSLSFKLQRNIGYFVFQTYLPSILIVMLSWVS 277
                |.:.|.|:.::|....:...|.:||.|..::..|.|:|.|||||.|||||.|:.|:||.||
Zfish   204 VVEEESSRLNQYDLLGQTVGNETIRSSTGEYTVMTAHFHLKRKIGYFVIQTYLPCIMTVILSQVS 268

  Fly   278 FWINHEATSARVALGITTVLTMTTISTGVRSSLPRISYVKAIDIYLVMCFVFVFAALLEYAAVNY 342
            ||:|.|:..||...|:||||||||:|...|:|||:::|..|:|.::.:|:.|||:||:|:|.|||
Zfish   269 FWLNRESVPARTVFGVTTVLTMTTLSISARNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNY 333

  Fly   343  342
            Zfish   334  333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcch3NP_996469.1 LIC 15..493 CDD:273305 130/325 (40%)
Neur_chan_LBD 47..256 CDD:280998 76/212 (36%)
Neur_chan_memb 263..490 CDD:280999 44/80 (55%)
LOC100001259XP_021336767.1 Neur_chan_LBD 7..>350 CDD:332142 130/325 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.