DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8916 and GABRA5

DIOPT Version :9

Sequence 1:NP_573090.3 Gene:CG8916 / 32553 FlyBaseID:FBgn0030707 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_000801.1 Gene:GABRA5 / 2558 HGNCID:4079 Length:462 Species:Homo sapiens


Alignment Length:504 Identity:177/504 - (35%)
Similarity:266/504 - (52%) Gaps:102/504 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 DMLSRNISM---ILENLLKRYEQSQLPTHGQGVPTVVQTNILIRSMGPVSELDMDYSMDCYFRQY 163
            |..:.||::   ||:.||..|:....|..|:.: |.|:|:|.:.|.||||:.:|:|::|.:|||.
Human    40 DETNDNITIFTRILDGLLDGYDNRLRPGLGERI-TQVRTDIYVTSFGPVSDTEMEYTIDVFFRQS 103

  Fly   164 WRDKRLSFKGPIKSLSLSIKMLDKIWRPDTYFYNGKHSQIHMITVPNKLLRLDQNGGILYSMRLT 228
            |:|:||.||||::.|.|:..:..|||.|||:|:|||.|..|.:|.|||||||:.:|.:||:||||
Human   104 WKDERLRFKGPMQRLPLNNLLASKIWTPDTFFHNGKKSIAHNMTTPNKLLRLEDDGTLLYTMRLT 168

  Fly   229 IKATCPMELQNFPMDRQSCPLVIGSYGYINQQLIYEWKN--QDDAVSFVPGMTLNQFDLI--SMM 289
            |.|.|||:|::||||..:|||..|||.|.|.:::|.|.|  ....|....|..|||:.|:  ::.
Human   169 ISAECPMQLEDFPMDAHACPLKFGSYAYPNSEVVYVWTNGSTKSVVVAEDGSRLNQYHLMGQTVG 233

  Fly   290 HRNFTTVRREGDFSVLHVAFNLKRHTGYFLIQVYVPCILIVVLSWVSFWIHREATSDRVSLCVTS 354
            ..|.:|  ..|:::::...|:|||..|||:||.|:|||:.|:||.||||::||:...|....||:
Human   234 TENIST--STGEYTIMTAHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTT 296

  Fly   355 VLTLSTISLDSRTDLPKVKYATALDWFLLMSFLYCIATLLEFAGVHYFTKLGSGESPQLEDQWED 419
            |||::|:|:.:|..||||.||||:|||:.:.:.:..:.|:|||.|:||||.|..        |  
Human   297 VLTMTTLSISARNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGWA--------W-- 351

  Fly   420 ICIANSLSDHAGEVDGDGEADADPFADEDSSNGSENDDNEAGASESVESKSGVCVCNKNDALGLE 484
                                                |..:|..:..::.|..| :.||:      
Human   352 ------------------------------------DGKKALEAAKIKKKREV-ILNKS------ 373

  Fly   485 YEVSLQNSLAGAGFLKRNAIFCPTYNDPSYILPNTMERTTQTEPPAVSRLHQMWMCLKSDNSFRK 549
                            .||......:.|    ||..:..|   |...|....:        |.:.
Human   374 ----------------TNAFTTGKMSHP----PNIPKEQT---PAGTSNTTSV--------SVKP 407

  Fly   550 QRERNAAAQKSEQGGANCYVNSVSLIDRVARIAFPMSFAFLNLLYWWAY 598
            ..|:.:.::|:        .||:|.||:::||.||:.|...||:||..|
Human   408 SEEKTSESKKT--------YNSISKIDKMSRIVFPVLFGTFNLVYWATY 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8916NP_573090.3 LIC 92..598 CDD:273305 176/502 (35%)
Neur_chan_LBD 111..315 CDD:280998 93/207 (45%)
Neur_chan_memb 322..>403 CDD:280999 39/80 (49%)
GABRA5NP_000801.1 LGIC_ECD_GABAAR_A5 58..256 CDD:349839 88/200 (44%)
LGIC_TM_GABAAR_alpha 259..445 CDD:349854 77/277 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 377..412 8/49 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 199 1.000 Domainoid score I3055
eggNOG 1 0.900 - - E1_KOG3644
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 373 1.000 Inparanoid score I2115
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1057372at2759
OrthoFinder 1 1.000 - - FOG0000415
OrthoInspector 1 1.000 - - otm41856
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18945
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X127
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.970

Return to query results.
Submit another query.