DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8916 and lgc-32

DIOPT Version :9

Sequence 1:NP_573090.3 Gene:CG8916 / 32553 FlyBaseID:FBgn0030707 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_508139.2 Gene:lgc-32 / 188603 WormBaseID:WBGene00020569 Length:390 Species:Caenorhabditis elegans


Alignment Length:325 Identity:73/325 - (22%)
Similarity:129/325 - (39%) Gaps:61/325 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 ADMLSRNISMILENLLKRYEQSQLPTHGQGVPTVVQTNILIRSMGPVSELDMDYSMDCYFRQYWR 165
            ||:|.||                  :|..| ..|:::|..| :....:.:..:.|.:.:|...|.
 Worm    29 ADLLGRN------------------SHSSG-EIVIKSNYKI-AKWLYNSVAHELSTEGFFEMSWT 73

  Fly   166 DKRLSFKG--------PIKSLSLSIKMLDKIWRPDTYF---YNGKHSQIHMITVPNKLLRLDQNG 219
            :..|.|..        .||||      |...|.|..||   ||.:.|:    .:.|  :.:.::|
 Worm    74 NTTLDFTNLNACHKTVRIKSL------LHIFWLPHVYFPFSYNLEESR----NLYN--IEIHESG 126

  Fly   220 GILYSMRLTIKATCPMELQNFPMDRQSCPLVIGSYGYIN----QQLIYEWKNQDDAVSFVPGMTL 280
            .|..|.||.....|..:..:.|....:|.|   |:.|.|    |:::.|..|..|:|.....   
 Worm   127 NITLSKRLKQSIPCKEQSDSHPFSNNTCTL---SWKYTNLDNYQKIVIEPSNLMDSVEREHS--- 185

  Fly   281 NQFDLISMMHRNFTTVRREGDFSVLHVAFNLKRHTGYFLIQVYVPCILIVVLSWVSFWIHREATS 345
            .||.|     ::.|......|...||  :.:.:...|.|:..:.|.:|.::..|:|..:...|.:
 Worm   186 RQFIL-----KDVTFESSGDDEQRLH--YTITQTPQYLLLHFFFPALLFLIPPWLSLLLGPMAIT 243

  Fly   346 DRVSLCVTSVLTLSTISLDSRTDLPKVKYATALDWFLLMSFLYCIATLLEFAGVHYFTKLGSGES 410
             |..:.:||::.||.....:.|..|......|:..:.|.:::|.|..::|...:..|..:|..::
 Worm   244 -RCIILMTSLILLSNHYDRNVTVFPIDASLNAISIWQLFTYIYVIGIVIELIIITLFASMGRSKT 307

  Fly   411  410
             Worm   308  307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8916NP_573090.3 LIC 92..598 CDD:273305 73/325 (22%)
Neur_chan_LBD 111..315 CDD:280998 47/218 (22%)
Neur_chan_memb 322..>403 CDD:280999 17/80 (21%)
lgc-32NP_508139.2 LIC 61..>286 CDD:273305 58/250 (23%)
LGIC_ECD 61..>162 CDD:355788 29/115 (25%)
Cys-loop 140..154 CDD:349787 2/13 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3644
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.