DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8916 and lgc-34

DIOPT Version :9

Sequence 1:NP_573090.3 Gene:CG8916 / 32553 FlyBaseID:FBgn0030707 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_493752.1 Gene:lgc-34 / 173443 WormBaseID:WBGene00020836 Length:390 Species:Caenorhabditis elegans


Alignment Length:325 Identity:79/325 - (24%)
Similarity:131/325 - (40%) Gaps:60/325 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 ILENLLKRYEQSQLP---THGQGVPTVVQTNILIRSM---GPVSELDMDYSMDCYFRQYWRDKRL 169
            |:..:|..|:.|..|   .|......:|.|||.|..:   ...:|:|:      |.||.|:|.||
 Worm    33 IVGRILSEYDSSSRPPVRDHADNSAILVITNIFINRLIWHNNYAEVDL------YLRQQWQDSRL 91

  Fly   170 SFKGPIKSLSLSIKMLD--KIWRPDTYFYNGKH------SQIHMITVPNKLLRLDQNGGILYSMR 226
            .:....:.....|::..  |||.|||||.:||.      :..|::..|:..:|..:.  :|..:.
 Worm    92 KYDVDTREGIDEIRLPGNRKIWEPDTYFTSGKELSRNEKNSKHIVVEPSGYIRSSER--VLLELP 154

  Fly   227 LTIKATCPMELQNFPMDRQSCPLVIGSYGYINQQLIYEWKNQDDAVSFVP--------GMTLNQF 283
            .......|     |...|| ..:.:|||.|....::|.|.|....|:.:.        .:|..:.
 Worm   155 YAYGTMFP-----FTNSRQ-FTIKLGSYNYDIDDIVYLWANSPPLVNPIEVSQDLLKGDLTFEEA 213

  Fly   284 ---DLISMMHRNFTTVRREGDFSVL--HVAFNLKRHTGYFLIQVYVPCILIVVLSWVSFWIHREA 343
               |.:.    |:|.    |.:|.:  ||.|:....:|  |:..::|.:.:::.||:.||||...
 Worm   214 SAGDCVG----NYTV----GVYSCIDAHVYFSASTISG--LMSWFLPSLFLLIGSWLHFWIHGSW 268

  Fly   344 TSDRVSLCVTSVLTLSTISLDSRTDLPKVKYATALDWFLLMSFLYCIATLLEFAGVHYFTKLGSG 408
            :..|..........|:...:..|.|    .|..|...:|    .:|: .|..|:.|.||..:..|
 Worm   269 SVPRTISAAVPFFILAAYYIFMRED----SYTQAQGAWL----AFCL-VLTFFSFVEYFLVICCG 324

  Fly   409  408
             Worm   325  324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8916NP_573090.3 LIC 92..598 CDD:273305 79/325 (24%)
Neur_chan_LBD 111..315 CDD:280998 56/230 (24%)
Neur_chan_memb 322..>403 CDD:280999 19/80 (24%)
lgc-34NP_493752.1 LIC 1..388 CDD:273305 79/325 (24%)
LGIC_ECD_anion 58..237 CDD:349788 49/200 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3644
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.