DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8916 and glra1

DIOPT Version :9

Sequence 1:NP_573090.3 Gene:CG8916 / 32553 FlyBaseID:FBgn0030707 Length:612 Species:Drosophila melanogaster
Sequence 2:XP_002940962.2 Gene:glra1 / 100498379 XenbaseID:XB-GENE-6035798 Length:450 Species:Xenopus tropicalis


Alignment Length:537 Identity:160/537 - (29%)
Similarity:255/537 - (47%) Gaps:130/537 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 SSSEISNQRRVRRKAAADMLSRNISMILENLLKRYE--QSQLPTHGQGVPTVVQTNILIRSMGPV 147
            :|.|:....|    ::|.::|.  |..|:.|:.:..  .:::..:.:|.|..|..||.|.|.|.:
 Frog    22 ASKEVGASAR----SSAKLMSP--SDFLDKLMGKISGYDARIRPNFKGPPVNVSCNIFINSFGSI 80

  Fly   148 SELDMDYSMDCYFRQYWRDKRLSF-KGPIKSLSLSIKMLDKIWRPDTYFYNGKHSQIHMITVPNK 211
            :|..|||.::.:.||.|.|.||:: :.|..||.|...|||.||:||.:|.|.|.:..|.||..||
 Frog    81 AETTMDYRLNIFLRQQWNDPRLAYSEYPDDSLDLDPSMLDSIWKPDLFFANEKGANFHEITTDNK 145

  Fly   212 LLRLDQNGGILYSMRLTIKATCPMELQNFPMDRQSCPLVIGSYGYINQQLIYEWKNQDDAVSFVP 276
            |||:.:||.:|||:|||:...|||:|:|||||.|:|.:.:.|:||....||:||: :..||....
 Frog   146 LLRIFKNGNVLYSIRLTLTLACPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWE-EVGAVQVAE 209

  Fly   277 GMTLNQFDL-----ISMMHRNFTTVRREGDFSVLHVAFNLKRHTGYFLIQVYVPCILIVVLSWVS 336
            |:||.||.|     :....::::|    |.|:.:...|:|:|..||:|||:|:|.:|||:|||||
 Frog   210 GLTLPQFILKEEKDLRYCTKHYST----GKFTCIEARFHLERQMGYYLIQMYIPSLLIVILSWVS 270

  Fly   337 FWIHREATSDRVSLCVTSVLTLSTISLDSRTDLPKVKYATALDWFLLMSFLYCIATLLEFAGVHY 401
            |||:.:|...||.|.:|:|||::|.|..||..||||.|..|:|.::.:..|:..:.|||:|.|::
 Frog   271 FWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNF 335

  Fly   402 FTKLGSGESPQLEDQWEDICIANSLSDHAGEVDGDGEADADPFADEDSSNGSENDDNEAG----- 461
            .::           |.:::........|..|                       |:|..|     
 Frog   336 VSR-----------QHKELLRFRRRRRHHKE-----------------------DENAEGRFSFA 366

  Fly   462 ----ASESVESKSGVCVCNKNDALGLEYEVSLQNSLAGAGFLKRNAIFCPTYNDPSYILPNTMER 522
                ....:::|.|:.:...|:                              |:|:         
 Frog   367 AYGMGPACLQAKDGISMKGNNN------------------------------NNPA--------- 392

  Fly   523 TTQTEPPAVSRLHQMWMCLKSDNSFRKQRERNAAAQKSEQGGANCYVNSVSLIDRVARIAFPMSF 587
             :..:|.:           ||.:..||                 .:::....||:|:||.||:.|
 Frog   393 -SSAQPVS-----------KSPDEMRK-----------------LFISRAKKIDKVSRIGFPLVF 428

  Fly   588 AFLNLLYWWAYGMYKKE 604
            ...|..||..|.:.:.|
 Frog   429 LIFNTFYWIIYKIVRSE 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8916NP_573090.3 LIC 92..598 CDD:273305 156/522 (30%)
Neur_chan_LBD 111..315 CDD:280998 82/211 (39%)
Neur_chan_memb 322..>403 CDD:280999 38/80 (48%)
glra1XP_002940962.2 LIC 10..439 CDD:273305 158/529 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.