DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8916 and LOC100001259

DIOPT Version :9

Sequence 1:NP_573090.3 Gene:CG8916 / 32553 FlyBaseID:FBgn0030707 Length:612 Species:Drosophila melanogaster
Sequence 2:XP_021336767.1 Gene:LOC100001259 / 100001259 -ID:- Length:369 Species:Danio rerio


Alignment Length:337 Identity:151/337 - (44%)
Similarity:213/337 - (63%) Gaps:14/337 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 RRVRRKAAADMLSRNISM---ILENLLKRYEQSQLPTHGQGVPTVVQTNILIRSMGPVSELDMDY 154
            |.|...|..|....||::   ||:.||..|:....|..|..| |.|:|:|.:.|.||||:.||:|
Zfish    21 RSVSADATTDAFKNNITLFTRILDRLLDGYDNRLRPGLGDRV-TTVKTDIYVTSFGPVSDTDMEY 84

  Fly   155 SMDCYFRQYWRDKRLSFKGPIKSLSLSIKMLDKIWRPDTYFYNGKHSQIHMITVPNKLLRLDQNG 219
            ::|.:|||.|:|:||.|:||:..|.|:..|..|||.|||:|:|||.|..|.:|:||||||:..:|
Zfish    85 TIDVFFRQSWKDERLKFEGPMNILRLNNLMASKIWTPDTFFHNGKKSVAHNMTMPNKLLRIQDDG 149

  Fly   220 GILYSMRLTIKATCPMELQNFPMDRQSCPLVIGSYGYINQQLIYEW-KNQDDAVSF-VPGMTLNQ 282
            .:||:||||:.|.|||.|::||||..||||..|||.|...::.|.| ||..::|.. .....|||
Zfish   150 TLLYTMRLTVHAECPMHLEDFPMDFHSCPLKFGSYAYTTTEVTYTWTKNASNSVVVEEESSRLNQ 214

  Fly   283 FDLISMMHRNFTTVRREGDFSVLHVAFNLKRHTGYFLIQVYVPCILIVVLSWVSFWIHREATSDR 347
            :||:.....|.|.....|:::|:...|:|||..|||:||.|:|||:.|:||.||||::||:...|
Zfish   215 YDLLGQTVGNETIRSSTGEYTVMTAHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPAR 279

  Fly   348 VSLCVTSVLTLSTISLDSRTDLPKVKYATALDWFLLMSFLYCIATLLEFAGVHYFTKLGSGESPQ 412
            ....||:|||::|:|:.:|..||||.||||:|||:.:.:.:..:.|:|||.|:||||.|..    
Zfish   280 TVFGVTTVLTMTTLSISARNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGWA---- 340

  Fly   413 LEDQWEDICIAN 424
                |:...:.|
Zfish   341 ----WDGKSVVN 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8916NP_573090.3 LIC 92..598 CDD:273305 151/337 (45%)
Neur_chan_LBD 111..315 CDD:280998 95/205 (46%)
Neur_chan_memb 322..>403 CDD:280999 39/80 (49%)
LOC100001259XP_021336767.1 Neur_chan_LBD 7..>350 CDD:332142 151/337 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 199 1.000 Domainoid score I3005
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1057372at2759
OrthoFinder 1 1.000 - - FOG0000415
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.