DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Lrp4 and CD320

DIOPT Version :9

Sequence 1:	NP_727914.1	Gene:	Lrp4 / 32552	FlyBaseID:	FBgn0030706	Length:	2009	Species:	Drosophila melanogaster
Sequence 2:	NP_057663.1	Gene:	CD320 / 51293	HGNCID:	16692	Length:	282	Species:	Homo sapiens

Alignment Length:	137	Identity:	51/137 - (37%)
Similarity:	62/137 - (45%)	Gaps:	28/137 - (20%)

- Green bases have known domain annotations that are detailed below.

  Fly   346 SCPEGEFKCRGGLGGAGGPSGQCILNRFRCDGDNDCGDWSDEENCPQKPSLCTSNEYKCADGTCI 410
            |||..:|:||        .||.|:...:|||.|.||.|.||||.|..:|  ||..      |.|.
Human    53 SCPPTKFQCR--------TSGLCVPLTWRCDRDLDCSDGSDEEECRIEP--CTQK------GQCP 101

  Fly   411 PK---RWKCDKEQDCDGGEDE--NDCGSLGSEHPLTCGSDEFTCN-NGRCILKTWLCDGYPDCAA 469
            |.   ...|....||.||.|:  .:|..      |.|.:.|..|. :..||..||.|||:|||..
Human   102 PPPGLPCPCTGVSDCSGGTDKKLRNCSR------LACLAGELRCTLSDDCIPLTWRCDGHPDCPD 160

  Fly   470 GEDEVEC 476
            ..||:.|
Human   161 SSDELGC 167

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Lrp4	NP_727914.1	LDLa	267..301	CDD:238060
		LDLa	306..340	CDD:238060
		LDLa	347..390	CDD:238060	19/42 (45%)
		LDLa	397..431	CDD:238060	11/38 (29%)
		LDLa	442..476	CDD:238060	15/34 (44%)
		LDLa	480..521	CDD:238060
		FXa_inhibition	576..604	CDD:291342
		LY	634..671	CDD:214531
		NHL	<656..793	CDD:302697
		LY	680..714	CDD:214531
		NHL repeat	681..722	CDD:271320
		NHL repeat	726..760	CDD:271320
		LY	761..803	CDD:214531
		NHL repeat	769..793	CDD:271320
		FXa_inhibition	882..912	CDD:291342
		LY	946..985	CDD:214531
		NHL	<967..1142	CDD:302697
		LY	988..1030	CDD:214531
		NHL repeat	998..1037	CDD:271320
		NHL repeat	1038..1080	CDD:271320
		NHL repeat	1084..1119	CDD:271320
		FXa_inhibition	1185..1220	CDD:291342
		NHL	1260..>1445	CDD:302697
		NHL repeat	1260..1296	CDD:271320
		NHL repeat	1302..1337	CDD:271320
		NHL repeat	1345..1383	CDD:271320
		FXa_inhibition	<1499..1525	CDD:291342
		LY	1600..1640	CDD:214531
		LY	1643..1686	CDD:214531
		LY	1688..1729	CDD:214531
		FXa_inhibition	1801..>1825	CDD:291342
CD320	NP_057663.1	LDLa	54..89	CDD:238060	19/42 (45%)
CD320	NP_057663.1	LDLa	132..167	CDD:238060	15/34 (44%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG1215
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900