DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycD and CCNG2

DIOPT Version :9

Sequence 1:NP_523355.2 Gene:CycD / 32551 FlyBaseID:FBgn0010315 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_004345.1 Gene:CCNG2 / 901 HGNCID:1593 Length:344 Species:Homo sapiens


Alignment Length:294 Identity:63/294 - (21%)
Similarity:119/294 - (40%) Gaps:48/294 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 NCQEEVVLLALNYMDRFLSSKSVRKTQLQILAAACLLLASKLREPSCRALSVDLLVVYTDNSIYK 261
            :|.|..| ||:|.:||||:...|:...|..:.....|||:::.|..|...|...::..:......
Human    72 SCTETFV-LAVNILDRFLALMKVKPKHLSCIGVCSFLLAARIVEEDCNIPSTHDVIRISQCKCTA 135

  Fly   262 DDLIKWELYVLSRLGWDLSSVTPLDFLELL-MMRLPIGSKNFPDINIGKVRGHAQA----FISLA 321
            .|:.:.|..:..:|.::|.:.|.|:||.|. .:.|...|:....:::.|:....:|    .|   
Human   136 SDIKRMEKIISEKLH
YELEATTALNFLHLYHTIILCHTSERKEILSLDKLEAQLKACNCRLI--- 197

  Fly   322 AKEHKFAKFSASTIAASSIAASMNGLKWHLRSGHNLHFLLSLMTDLTSVEQAQ-------VRDCM 379
                 |:|...|.:|...:...:..||    |...|..|| |:...:.:...:       |..|:
Human   198 -----FSKAKPSVLALCLLNLEVETLK----SVELLEILL-LVKKHSKINDTEFFYWRELVSKCL 252

  Fly   380 LHMEDIFKEHSRNLEPFLVNIDPKEMSTLYYKRRFQIHQSQHLSQISIRPLP-LPKAPAECVEQH 443
                   .|:|   .|.....|.|::..:..:|   ..|:.|.|..|:..|| :|:  ..|.::.
Human   253 -------AEYS---SPECCKPDLKKLVWIVSRR---TAQNLHNSYYSVPELPTIPE--GGCFDES 302

  Fly   444 QQQHNFGSAAPHRTHTCKMQAQAQAQNEIQDVTF 477
            :.:.:.      ...:|..::.:.:....|:.||
Human   303 ESEDSC------EDMSCGEESLSSSPPSDQECTF 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycDNP_523355.2 Cyclin_N 155..280 CDD:278560 21/82 (26%)
Cyclin_C 282..>392 CDD:281044 25/121 (21%)
CCNG2NP_004345.1 CYCLIN_CCNG2 55..150 CDD:410287 20/78 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 301..320 1/24 (4%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146236
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.