Sequence 1: | NP_523355.2 | Gene: | CycD / 32551 | FlyBaseID: | FBgn0010315 | Length: | 477 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001752.2 | Gene: | CCNF / 899 | HGNCID: | 1591 | Length: | 786 | Species: | Homo sapiens |
Alignment Length: | 332 | Identity: | 66/332 - (19%) |
---|---|---|---|
Similarity: | 133/332 - (40%) | Gaps: | 83/332 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 140 TAIGDPTLYSDRCLENFLKVEEKHHK--------------------------------------- 165
Fly 166 -IPDTYFSIQKDITPPMRKIVAEWMMEVCAEENCQEEVVLLALNYMDRFLSSKSVRKTQLQILAA 229
Fly 230 ACLLLASKLREPSCRALSVDLLVV-----YTDNSIYKDDLIKWELYVLSRLGWDLSSVTPLDFLE 289
Fly 290 LLMMRLPIGSKNFPDINIGKVRGHAQAFI-SLAAKEHKFAKFSASTIAASSIAASMNGLKWHLRS 353
Fly 354 GHNLHFLLSLMTDLTSVEQAQVRDCMLHM-EDIFKEHSRNLEPFLVNIDPKEMSTLYYKRRFQIH 417
Fly 418 QSQHLSQ 424 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CycD | NP_523355.2 | Cyclin_N | 155..280 | CDD:278560 | 33/169 (20%) |
Cyclin_C | 282..>392 | CDD:281044 | 20/111 (18%) | ||
CCNF | NP_001752.2 | Nuclear localization signal 1. /evidence=ECO:0000269|PubMed:10716937 | 20..28 | ||
F-box domain | 29..76 | ||||
FBOX | 35..73 | CDD:197608 | |||
TPR | <88..>146 | CDD:223861 | |||
SLR repeat | 88..112 | CDD:276807 | |||
Cyclin_N | 281..406 | CDD:278560 | 30/131 (23%) | ||
Cyclin_C | 421..531 | CDD:281044 | 23/132 (17%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 564..593 | ||||
Nuclear localization signal 2. /evidence=ECO:0000269|PubMed:10716937 | 568..574 | ||||
PEST | 582..766 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 675..738 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165146244 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |