DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycD and CCND3

DIOPT Version :9

Sequence 1:NP_523355.2 Gene:CycD / 32551 FlyBaseID:FBgn0010315 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_001751.1 Gene:CCND3 / 896 HGNCID:1585 Length:292 Species:Homo sapiens


Alignment Length:319 Identity:114/319 - (35%)
Similarity:164/319 - (51%) Gaps:56/319 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 DPTLYSD-RCLENFLKVEEKHHKIP-DTYFS-IQKDITPPMRKIVAEWMMEVCAEENCQEEVVLL 205
            ||.|..| |.|::.|::||::  :| .:||. :|::|.|.|||::|.||:|||.|:.|:|||..|
Human    18 DPRLLGDQRVLQSLLRLEERY--VPRASYFQCVQREIKPHMRKMLAYWMLEVCEEQRCEEEVFPL 80

  Fly   206 ALNYMDRFLSSKSVRKTQLQILAAACLLLASKLREPSCRALSVDLLVVYTDNSIYKDDLIKWELY 270
            |:||:||:||....||.|||:|.|.|:||||||||.:  .|:::.|.:|||:::....|..||:.
Human    81 AMNYLDRYLSCVPTRKAQLQLLGAVCMLLASKLRETT--PLTIEKLCIYTDHAVSPRQLRDWEVL 143

  Fly   271 VLSRLGWDLSSVTPLDFLELLMMRLPIGSKNFPDINIGKVRGHAQAFISLAAKEHKFAKFSASTI 335
            ||.:|.|||::|...|||..::.||     :.|......|:.|||.|::|.|.::.||.:..|.|
Human   144 VLGKLKWDLAAVIAHDFLAFILHRL-----SLPRDRQALVKKHAQTFLALCATDYTFAMYPPSMI 203

  Fly   336 AASSIAASMNGLKWHLRSGHNLHFLLSLMTDLTSVEQAQVRDCMLHMEDIFKEHSRNLEPFLVNI 400
            |..||.|::.||.....||..   |..|:..:|..|...:|.|...:|...:|..|         
Human   204 ATGSIGAAVQGLGACSMSGDE---LTELLAGITGTEVDCLRACQEQIEAALRESLR--------- 256

  Fly   401 DPKEMSTLYYKRRFQIHQSQHLSQISIRPLPLPKAPAECVEQHQQQHNFGSAAPHRTHT 459
                                ..||.|  ..|.||||          ....|..|.:|.|
Human   257 --------------------EASQTS--SSPAPKAP----------RGSSSQGPSQTST 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycDNP_523355.2 Cyclin_N 155..280 CDD:278560 60/126 (48%)
Cyclin_C 282..>392 CDD:281044 34/109 (31%)
CCND3NP_001751.1 Cyclin_N 27..153 CDD:306612 61/129 (47%)
Cyclin_C 155..>251 CDD:308564 33/103 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 254..292 13/71 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146242
Domainoid 1 1.000 126 1.000 Domainoid score I5412
eggNOG 1 0.900 - - E1_KOG0656
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 180 1.000 Inparanoid score I4005
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001275
OrthoInspector 1 1.000 - - otm41358
orthoMCL 1 0.900 - - OOG6_105230
Panther 1 1.100 - - O PTHR10177
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1298
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.750

Return to query results.
Submit another query.