DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycD and CCND2

DIOPT Version :9

Sequence 1:NP_523355.2 Gene:CycD / 32551 FlyBaseID:FBgn0010315 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_001750.1 Gene:CCND2 / 894 HGNCID:1583 Length:289 Species:Homo sapiens


Alignment Length:268 Identity:106/268 - (39%)
Similarity:161/268 - (60%) Gaps:20/268 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 DNVNTAIGDPTLY-SDRCLENFLKVEEKHHKIPD-TYFS-IQKDITPPMRKIVAEWMMEVCAEEN 197
            |.|..|:.|..|. .||.|:|.|.:||::  :|. :||. :||||.|.||::||.||:|||.|:.
Human     9 DPVRRAVRDRNLLRDDRVLQNLLTIEERY--LPQCSYFKCVQKDIQPYMRRMVATWMLEVCEEQK 71

  Fly   198 CQEEVVLLALNYMDRFLSSKSVRKTQLQILAAACLLLASKLREPSCRALSVDLLVVYTDNSIYKD 262
            |:|||..||:||:||||:.....|:.||:|.|.|:.|||||:|.|  .|:.:.|.:||||||...
Human    72 CEEEVFPLAMNYLDRFLAGVPTPKSHLQLLGAVCMFLASKLKETS--PLTAEKLCIYTDNSIKPQ 134

  Fly   263 DLIKWELYVLSRLGWDLSSVTPLDFLELLMMRLPIGSKNFPDINIGKVRGHAQAFISLAAKEHKF 327
            :|::|||.||.:|.|:|::|||.||:|.::.:||...:     .:..:|.|||.||:|.|.:.||
Human   135 ELLEWELVVLGKLKWNLAAVTPHDFIEHILRKLPQQRE-----KLSLIRKHAQTFIALCATDFKF 194

  Fly   328 AKFSASTIAASSIAASMNGLKWHLR-SGHNLHFLLSLMTDLTSVE-------QAQVRDCMLHMED 384
            |.:..|.||..|:.|::.||:.... |......|..|:..:|:.:       |.|:...:|:...
Human   195 AMYPPSMIATGSVGAAICGLQQDEEVSSLTCDALTELLAKITNTDVDCLKACQEQIEAVLLNSLQ 259

  Fly   385 IFKEHSRN 392
            .:::..|:
Human   260 QYRQDQRD 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycDNP_523355.2 Cyclin_N 155..280 CDD:278560 63/126 (50%)
Cyclin_C 282..>392 CDD:281044 33/117 (28%)
CCND2NP_001750.1 Cyclin_N 25..152 CDD:365896 65/130 (50%)
Cyclin_C 154..>257 CDD:367282 33/107 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 264..289 1/4 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146240
Domainoid 1 1.000 126 1.000 Domainoid score I5412
eggNOG 1 0.900 - - E1_KOG0656
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37525
Inparanoid 1 1.050 180 1.000 Inparanoid score I4005
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001275
OrthoInspector 1 1.000 - - otm41358
orthoMCL 1 0.900 - - OOG6_105230
Panther 1 1.100 - - LDO PTHR10177
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4378
SonicParanoid 1 1.000 - - X1298
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.780

Return to query results.
Submit another query.