DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycD and CCNA1

DIOPT Version :9

Sequence 1:NP_523355.2 Gene:CycD / 32551 FlyBaseID:FBgn0010315 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_003905.1 Gene:CCNA1 / 8900 HGNCID:1577 Length:465 Species:Homo sapiens


Alignment Length:251 Identity:76/251 - (30%)
Similarity:119/251 - (47%) Gaps:30/251 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 TDNVNTAIGDPTLYSDRCLENFLKVEEKHHKIPDTYFSIQKDITPPMRKIVAEWMMEVCAEENCQ 199
            ||.:|.     |.|::. :..:|:..|..|:....|...|.|||..||.|:.:|::||..|...:
Human   203 TDVINV-----TEYAEE-IYQYLREAEIRHRPKAHYMKKQPDITEGMRTILVDWLVEVGEEYKLR 261

  Fly   200 EEVVLLALNYMDRFLSSKSVRKTQLQILAAACLLLASKLRE--PSCRALSVDLLVVYTDNSIYKD 262
            .|.:.||:|::|||||..||.:.:||::..|.:|||||..|  |.    .||..|..||::..|.
Human   262 AETLYLAVNFLDRFLSCMSVLRGKLQLVGTAAMLLASKYEEIYPP----EVDEFVYITDDTYTKR 322

  Fly   263 DLIKWELYVLSRLGWDLSSVTPLDFLELLMMRLPIGSKNFPDINIGKVRGHAQAFISLAAKEHKF 327
            .|:|.|..:|..|.:||:..|...||...:.|..:..:.   .|:.|.    .|.:||...: .|
Human   323 QLLKMEHLLLKVLAFDLTVPTTNQFLLQYLRRQGVCVRT---ENLAKY----VAELSLLEAD-PF 379

  Fly   328 AKFSASTIAASSIAASMNGLKWHLRSGHNLHFLLSLMTDLTSVEQAQVRDCM--LH 381
            .|:..|.|||::...:...:        |.||....:...|....:::..|:  ||
Human   380 LKYLPSLIAAAAFCLANYTV--------NKHFWPETLAAFTGYSLSEIVPCLSELH 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycDNP_523355.2 Cyclin_N 155..280 CDD:278560 48/126 (38%)
Cyclin_C 282..>392 CDD:281044 22/102 (22%)
CCNA1NP_003905.1 Cyclin_N2 71..>145 CDD:293109
Cyclin_N 214..340 CDD:278560 48/130 (37%)
Cyclin_C 342..459 CDD:281044 22/102 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146249
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.