DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycD and CLN1

DIOPT Version :9

Sequence 1:NP_523355.2 Gene:CycD / 32551 FlyBaseID:FBgn0010315 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_013926.1 Gene:CLN1 / 855239 SGDID:S000004812 Length:546 Species:Saccharomyces cerevisiae


Alignment Length:315 Identity:52/315 - (16%)
Similarity:112/315 - (35%) Gaps:91/315 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 LENFLKVEEKHHKIPDTYFSIQKDITPP---------------MRKIVAEWMMEVCAEENCQEEV 202
            |.::..::|.|.:|..... :|...|.|               .|:.:..::.::.........:
Yeast    29 LTHYETIQEYHEEISQNVL-VQSSKTKPDIKLIDQQPEMNPHQTREAIVTFLYQLSVMTRVSNGI 92

  Fly   203 VLLALNYMDRFLSSKSVRKTQLQILAAACLLLASKL---------------------REPSCRAL 246
            ...|:.:.||:.|.:.|.|.|.:::...||.||:|.                     ..|..|..
Yeast    93 FFHAVRFYDRYCSKRVVLKDQAKLVVGTCLWLAAKTWGGCNHIINNVSIPTGGRFYGPNPRARIP 157

  Fly   247 SVDLLVVYTDNSIYKDD--LIKWELYVLSRLGWDLSSVTPLDFL-----------ELLMMRLPIG 298
            .:..||.|...|...|:  .|:.|.::|..|.||:......|::           ||...:|...
Yeast   158 RLSELVHYCGGSDLFDESMFIQMERHILDTLNWDVYEPMINDYILNVDENCLIQYELYKNQLQNN 222

  Fly   299 SKNFPDINIGKVRGHAQAFISLAAKEHKFAKFSASTIAASSIAASMNGLKWHLRSGHNLHFLLSL 363
            :.|..:.:. |.:..:........:||         |::|..:..::|                 
Yeast   223 NSNGKEWSC-KRKSQSSDDSDATVEEH---------ISSSPQSTGLDG----------------- 260

  Fly   364 MTDLTSVEQAQVRDCMLHMEDIFKEHSRNLEPFLVNIDPKEMSTLYYKRRFQIHQ 418
              |.|::::.:..:..:.:        .||:.||:::...:.:.|    :|::::
Yeast   261 --DTTTMDEDEELNSKIKL--------INLKRFLIDLSCWQYNLL----KFELYE 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycDNP_523355.2 Cyclin_N 155..280 CDD:278560 32/162 (20%)
Cyclin_C 282..>392 CDD:281044 13/120 (11%)
CLN1NP_013926.1 COG5024 31..539 CDD:227357 51/313 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343513
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10177
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.