DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycD and CYCD1;1

DIOPT Version :9

Sequence 1:NP_523355.2 Gene:CycD / 32551 FlyBaseID:FBgn0010315 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_177178.1 Gene:CYCD1;1 / 843357 AraportID:AT1G70210 Length:339 Species:Arabidopsis thaliana


Alignment Length:313 Identity:90/313 - (28%)
Similarity:138/313 - (44%) Gaps:57/313 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 VEEKHHKIP-DTYFS--IQKDITPPMRKIVAEWMMEVCAEENCQEEVVLLALNYMDRFLSSKSVR 220
            :|::.|.:| ..|.|  ..:.:....|:....|:::|.|..|.|.....||:|||||||.::.:.
plant    56 IEDERHFVPGHDYLSRFQTRSLDASAREDSVAWILKVQAYYNFQPLTAYLAVNYMDRFLYARRLP 120

  Fly   221 KTQ---LQILAAACLLLASKLRE---PSCRALSVDLLVVYTDNSIYKDDLIKWELYVLSRLGWDL 279
            :|.   :|:||.|||.||:|:.|   ||.    .|..|...........:.:.||.|||.|.|.|
plant   121 ETSGWPMQLLAVACLSLAAKMEEILVPSL----FDFQVAGVKYLFEAKTIKRMELLVLSVLDWRL 181

  Fly   280 SSVTPLDFLELLMMRL-PIGSKNFPDINIGKVRGHAQAFISLAAKEHKFAKFSASTIAASSIAAS 343
            .||||.||:.....:: |.|:      .:|....||...|....||..|.::..|:|||::|...
plant   182 R
SVTPFDFISFFAYKIDPSGT------FLGFFISHATEIILSNIKEASFLEYWPSSIAAAAILCV 240

  Fly   344 MNGLKWHLRSGHNLHFLLSLMTDLTSVEQAQVRDCMLHMEDIFKEHSRNLEPFLVNIDPKEMSTL 408
            .|.|. .|.|..|.|.......|..|.|:. || |...|:.:..|::|      :| .||.::.|
plant   241 ANELP-SLSSVVNPHESPETWCDGLSKEKI-VR-CYRLMKAMAIENNR------LN-TPKVIAKL 295

  Fly   409 YYKRRFQIHQSQHLSQISIRPLPLPKAPAECVEQHQQQHNFGSAAPHRTHTCK 461
                           ::|:|.......|::       :.:|.|::|     ||
plant   296 ---------------RVSVRASSTLTRPSD-------ESSFSSSSP-----CK 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycDNP_523355.2 Cyclin_N 155..280 CDD:278560 42/129 (33%)
Cyclin_C 282..>392 CDD:281044 33/110 (30%)
CYCD1;1NP_177178.1 Cyclin_N 50..182 CDD:365896 42/129 (33%)
Cyclin_C 184..308 CDD:367282 40/154 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10177
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.