DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycD and CYCD1;1

DIOPT Version :10

Sequence 1:NP_523355.2 Gene:CycD / 32551 FlyBaseID:FBgn0010315 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_177178.1 Gene:CYCD1;1 / 843357 AraportID:AT1G70210 Length:339 Species:Arabidopsis thaliana


Alignment Length:56 Identity:13/56 - (23%)
Similarity:15/56 - (26%) Gaps:27/56 - (48%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 LLANPHAHLKLTFKKTGETYS---------------------------WSAPKCAI 204
            ||.....|..|...|.||||:                           |..|:|.|
plant     6 LLKTAQGHPMLVELKNGETYNGHLVNCDTWMNIHLREVICTSKDGDRFWRMPECYI 61

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycDNP_523355.2 CYCLIN_SF 144..278 CDD:477360 13/56 (23%)
CYCLIN_CCND_rpt2 283..387 CDD:410220
CYCD1;1NP_177178.1 CYCLIN_AtCycD-like_rpt1 81..179 CDD:410246
CYCLIN_AtCycD-like_rpt2 184..276 CDD:410247
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.