DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycD and CYCA1;1

DIOPT Version :9

Sequence 1:NP_523355.2 Gene:CycD / 32551 FlyBaseID:FBgn0010315 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_175077.1 Gene:CYCA1;1 / 841014 AraportID:AT1G44110 Length:460 Species:Arabidopsis thaliana


Alignment Length:331 Identity:78/331 - (23%)
Similarity:148/331 - (44%) Gaps:53/331 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 TQSIQSYPRYISQEPPTSHCQRLDERLTTTADPPATDNVNTAIGDPTLYSDRCLENF--LKVEEK 162
            |.:.::...|.|:: ..|..:::|:....        |:::..|||.|.:....:.:  |:..|.
plant   152 TPNSETIDNYCSRD-VLSDMKKMDKNQIV--------NIDSNNGDPQLCATFACDIYKHLRASEA 207

  Fly   163 HHKIPDTYF--SIQKDITPPMRKIVAEWMMEVCAEENCQEEVVLLALNYMDRFLSSKSVRKTQLQ 225
             .|.||..:  .:|||:...||.|:.:|::||..|.....|.:.|.:||:||:||...:.:.:||
plant   208 -KKRPDVDYMERVQKDVNSSMRGILVDWLIEVSEEYRLVPETLYLTVNYIDRYLSGNVISRQKLQ 271

  Fly   226 ILAAACLLLASKLREPSCRALSVDLLVVYTDNSIYKDDLIKWELYVLSRLGWDLSSVTPLDFLEL 290
            :|..||:::|:|..| .| |..|:.....|||:..||:::..|..||:.|.:::::.|...||. 
plant   272 LLGVACMMIAAKYEE-IC-APQVEEFCYITDNTYLKDEVLDMESDVLNYLKFEMTAPTTKCFLR- 333

  Fly   291 LMMRLPIGSKNFPDINIGKVRGHAQAFISLAAKEHKFAKFSASTIAASSIAASMNGL-----KWH 350
            ..:|...|....|   :.::...|.....|:..|:.....|.|.:|||:|..:...|     .|:
plant   334 RFVRAAHGVHEAP---LMQLECMANYIAELSLLEYTMLSHSPSLVAASAIFLAKYILDPTRRPWN 395

  Fly   351 LRSGHNLHFLLSLMTDLTSVEQAQVRDCMLHMEDI---------------FKEHSRNL--EPFLV 398
                       |.:...|..:..::|.|:..::.:               :.:|....  :.|..
plant   396 -----------STLQHYTQYKAMELRGCVKDLQRLCSTAHGSTLPAVREKYSQHKYKFVAKKFCP 449

  Fly   399 NIDPKE 404
            ::.|:|
plant   450 SVIPQE 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycDNP_523355.2 Cyclin_N 155..280 CDD:278560 43/128 (34%)
Cyclin_C 282..>392 CDD:281044 22/129 (17%)
CYCA1;1NP_175077.1 CYCLIN_AtCycA_like_rpt1 187..322 CDD:410265 46/137 (34%)
CYCLIN_AtCycA-like_rpt2 326..440 CDD:410210 22/128 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10177
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.