DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycD and CYCD3;2

DIOPT Version :9

Sequence 1:NP_523355.2 Gene:CycD / 32551 FlyBaseID:FBgn0010315 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_001331659.1 Gene:CYCD3;2 / 836861 AraportID:AT5G67260 Length:404 Species:Arabidopsis thaliana


Alignment Length:261 Identity:64/261 - (24%)
Similarity:116/261 - (44%) Gaps:23/261 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 RKIVAEWMMEVCAEENCQEEVVLLALNYMDRFLSS---KSVRKTQLQILAAACLLLASKLREPSC 243
            ||...:|::.|.:.........:||:||.|||::|   ::.:....|::|.|.|.||:|:.|...
plant    96 RKEALDWVLRVKSHYGFTSLTAILAVNYFDRFMTSIKLQTDKPWMSQLVAVASLSLAAKVEEIQV 160

  Fly   244 RALSVDLLVVYTDNSIYKDDLIKWELYVLSRLGWDLSSVTPLDFLELLMMRLPIGSKNFPDINIG 308
             .|.:||.|...........:.:.||.:||.|.|.:..|||:.|.:.::.|  .|||....::. 
plant   161 -PLLLDLQVEEARYLFEAKTIQRMELLILSTLQWRMHPVTPISFFDHIIRR--FGSKWHQQLDF- 221

  Fly   309 KVRGHAQAFISLAAKEHKFAKFSASTIAASSIAASMNGLKWHLRSGHNLHFLLSLMTDLTSVEQA 373
             .|...:..||:.| :.:|.::..|.:|.:.:......||    ....:.: .|.:|.|..|.|.
plant   222 -CRKCERLLISVIA-DTRFMRYFPSVLATAIMILVFEELK----PCDEVEY-QSQITTLLKVNQE 279

  Fly   374 QVRDCMLHMEDIFKEHSRNLEPFLVNIDPKEMSTLY-----YKRRFQIHQSQHLSQISIRPLPLP 433
            :|.:|.    ::..||:.:.:..:..:|....|.:.     ....:.:..:..:|..|..|.||.
plant   280 KVNECY----ELLLEHNPSKKRMMNLVDQDSPSGVLDFDDSSNSSWNVSTTASVSSSSSSPEPLL 340

  Fly   434 K 434
            |
plant   341 K 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycDNP_523355.2 Cyclin_N 155..280 CDD:278560 30/100 (30%)
Cyclin_C 282..>392 CDD:281044 26/109 (24%)
CYCD3;2NP_001331659.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10177
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.