DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycD and CYCD4;1

DIOPT Version :9

Sequence 1:NP_523355.2 Gene:CycD / 32551 FlyBaseID:FBgn0010315 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_001190620.1 Gene:CYCD4;1 / 836667 AraportID:AT5G65420 Length:318 Species:Arabidopsis thaliana


Alignment Length:237 Identity:64/237 - (27%)
Similarity:106/237 - (44%) Gaps:40/237 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 EEKHHKIPDTYF----SIQKDITPPMRKIVAEWMMEV---CA--EENCQEE-----VVLLALNYM 210
            :||.|...|.|.    |...|:... |:....|:.::   |.  .|.|:..     ...||:||:
plant    53 KEKQHLPSDDYIKRLRSGDLDLNVG-RRDALNWIWKIRGLCRTDREACEVHQFGPLCFCLAMNYL 116

  Fly   211 DRFLSSKSVRKTQ---LQILAAACLLLASKLREPSCRALSVDLLV-----VYTDNSIYKDDLIKW 267
            |||||...:...:   ||:||.|||.||:|:.|.....| :||.|     |:...|:.     :.
plant   117 DRFLSVHDLPSGKGWILQLLAVACLSLAAKIEETEVPML-IDLQVGDPQFVFEAKSVQ-----RM 175

  Fly   268 ELYVLSRLGWDLSSVTPLDFLELLMMRLPIGSKNFPDINIGKVRGHAQAFISLAAKEHKFAKFSA 332
            ||.||::|.|.|.::||..::...:.::....:...:..|.:    :...|:...|...|.:|..
plant   176 ELLVLNKLKWRLR
AITPCSYIRYFLRKMSKCDQEPSNTLISR----SLQVIASTTKGIDFLEFRP 236

  Fly   333 STIAASSIAASMNGLKWHLRSGHNLHFLLSLMTDLTSVEQAQ 374
            |.:|| ::|.|::|      ....:||..|..:.|.|:.|.:
plant   237 SEVAA-AVALSVSG------ELQRVHFDNSSFSPLFSLLQKE 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycDNP_523355.2 Cyclin_N 155..280 CDD:278560 44/141 (31%)
Cyclin_C 282..>392 CDD:281044 19/93 (20%)
CYCD4;1NP_001190620.1 Cyclin_N 45..188 CDD:278560 44/141 (31%)
Cyclin_C 191..>282 CDD:281044 19/92 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10177
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.