DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycD and CYCA3;1

DIOPT Version :9

Sequence 1:NP_523355.2 Gene:CycD / 32551 FlyBaseID:FBgn0010315 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_199122.1 Gene:CYCA3;1 / 834324 AraportID:AT5G43080 Length:355 Species:Arabidopsis thaliana


Alignment Length:316 Identity:78/316 - (24%)
Similarity:149/316 - (47%) Gaps:61/316 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 NVNTAIGDPTL---YSDRCLENFLKVEEKHHKIPDTYFSIQKDITPPMRKIVAEWMMEVCAEENC 198
            :::|...||.:   |.....|...::|.|...:.|....||||:|..||.::.:|::||..|...
plant    73 DIDTRSDDPQMCGPYVTSIFEYLRQLEVKSRPLVDYIEKIQKDVTSNMRGVLVDWLVEVAEEYKL 137

  Fly   199 QEEVVLLALNYMDRFLSSKSVRKTQLQILAAACLLLASKLRE--PSCRALSVDLLVVYTDNSIYK 261
            ..:.:.||::|:|||||.|:|.|.:||:|....:|:|||..|  |.    :||.....|||:..|
plant   138 LSDTLYLAVSYIDRFLSLKTVNKQRLQLLGVTSMLIASKYEEITPP----NVDDFCYITDNTYTK 198

  Fly   262 DDLIKWELYVLSRLGWDLSSVTPLDFLELLMMRLPIGSKNFPDINIGKVRGHAQ-----AFIS-L 320
            .:::|.|..:|..|.::|.:.|...||.....   :..::|.       ..|.|     :::| |
plant   199 QEIVKMEADILLALQFELGNPTSNTFLRRFTR---VAQEDFE-------MSHLQMEFLCSYLSEL 253

  Fly   321 AAKEHKFAKFSASTIAASSIAASMNGLK-----WHLRSGHNLHFLLSLMTDLTSVEQAQVRDCML 380
            :..:::..||..||:|||::..:...::     |::           ::.:.|..:...:::|:.
plant   254 SMLDYQSVKFLPSTVAASAVFLARFIIRPKQHPWNV-----------MLEEYTRYKAGDLKECVA 307

  Fly   381 HMEDIFKEHSRN---LEPFLVNIDPKEMSTLYYKRRFQIHQSQHLSQISIRP-LPL 432
            .:.|::.  ||.   ||..              :.:::.|:.:.::.:.:.| |||
plant   308 MIHDLYL--SRKCGALEAI--------------REKYKQHKFKCVATMPVSPELPL 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycDNP_523355.2 Cyclin_N 155..280 CDD:278560 44/126 (35%)
Cyclin_C 282..>392 CDD:281044 20/120 (17%)
CYCA3;1NP_199122.1 Cyclin_N 91..217 CDD:278560 45/129 (35%)
Cyclin_C 219..342 CDD:281044 24/159 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10177
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.