DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycD and CYCD7;1

DIOPT Version :9

Sequence 1:NP_523355.2 Gene:CycD / 32551 FlyBaseID:FBgn0010315 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_195831.1 Gene:CYCD7;1 / 831830 AraportID:AT5G02110 Length:341 Species:Arabidopsis thaliana


Alignment Length:266 Identity:54/266 - (20%)
Similarity:94/266 - (35%) Gaps:59/266 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 PPPPPPPPPTATQSIQSYPRYISQEPPTSHCQRLDERLTTTADPPATDNVNTAIGDPTLYSDRCL 153
            |..|..|.|......:|:...:.:..|......::|.:       |.|          |..:.|.
plant    11 PASPLTPEPLPNFRHRSHDNDVVKMYPEIDAATMEEAI-------AMD----------LEKELCF 58

  Fly   154 ENFLKVEEKHHKIPDTYFSIQKDITPPMRKIVAEWMMEVCAEENCQEEVVLLALNYMDRFL---S 215
            .|        |......|.:.|.:| ..|....:|:::..:..|...|.|..|.|..|||:   .
plant    59 NN--------HGDKFVEFFVSKKLT-DYRFHAFQWLIQTRSRLNLSYETVFSAANCFDRFVYMTC 114

  Fly   216 SKSVRKTQLQILAAACLLLASKLRE---PSCRALSVDLLVVYTDNSIYKDDLIKWELYVLSRLGW 277
            ........::::|...|.:|||..|   |....|.::.|.    :..:.:.:.:.||.:|..|.|
plant   115 CDEWTNWMVELVAVTSLSIASKFNEVTTPLLEELEMEGLT----HMFHVNTVAQMELIILKALEW 175

  Fly   278 DLSSVTPLDFLELLMMRLPIGSKNFPDINIGKVRGHAQAFISLAAKEH--------KFAKFSAST 334
            .:::||...|.:.|:.:            ||.|..|   .|......|        |..::..|.
plant   176 RVNAVTSYTFSQTLVSK------------IGMVGDH---MIMNRITNHLLDVICDLKMLQYPPSV 225

  Fly   335 IAASSI 340
            :|.::|
plant   226 VATAAI 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycDNP_523355.2 Cyclin_N 155..280 CDD:278560 29/130 (22%)
Cyclin_C 282..>392 CDD:281044 14/67 (21%)
CYCD7;1NP_195831.1 CYCLIN <84..178 CDD:294043 23/97 (24%)
Cyclin_C 180..278 CDD:281044 14/67 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10177
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.