DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycD and CYCD5;1

DIOPT Version :9

Sequence 1:NP_523355.2 Gene:CycD / 32551 FlyBaseID:FBgn0010315 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_195478.2 Gene:CYCD5;1 / 829917 AraportID:AT4G37630 Length:323 Species:Arabidopsis thaliana


Alignment Length:346 Identity:71/346 - (20%)
Similarity:126/346 - (36%) Gaps:110/346 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 TAIGDPTLYSDRCLENFLKVEEKHHKIPDTYFSIQKDITPPMRKIVAEWMMEVCAEENCQEEVVL 204
            |.|.|....:|..|:..|:.|    .:|      .|..:...|.|..:|::........|.:...
plant    40 TTIDDEDYVADLVLKENLRFE----TLP------SKTTSSSDRLIAIDWILTTRTRFGFQHQTAY 94

  Fly   205 LALNYMDRFLSSK--SVRKTQ---LQILAAACLLLASKLREPSCRALSVDLLVVYTDNS--IYKD 262
            :|::|.|.||..:  .::|.:   :::|:.|||.||:|:.|.....||     .|..:.  ::|.
plant    95 IAISYFDLFLHKRFIGLQKDETWAMRLLSVACLSLAAKMEERIVPGLS-----QYPQDHDFVFKP 154

  Fly   263 DLI-KWELYVLSRLGWDLSSVTPLDFLELLMMRLPIGSKNFPDINIGKVRGHAQAFISLAAKEHK 326
            |:| |.||.:||.|.|.::.:||..:....:.::   |::...::...|...:...:....||..
plant   155 DVIRKTELLILSTLDWKMNLITPFHYFNYFLAKI---SQDNHSVSKDLVLLRSSDSLLALTKEIS 216

  Fly   327 FAKF------SASTIAASS------------IAASMNGLKWHLRSGHNLHFLLSLMTDLTSVEQA 373
            |.::      :.:|:.|||            ||.....:.|                 .||.|..
plant   217 FTEYRQFVVAAVTTLLASSSTSSDIRLTREEIANKFGSISW-----------------WTSNENE 264

  Fly   374 QVRDCMLHMEDIFKEHSRNLEPFLVNIDPKEMSTLYYKRRFQIHQSQHLS---QISIRPLPLPKA 435
            .|..|                               |:|..:|.:.:|::   :|::...|    
plant   265 NVYLC-------------------------------YQRTLEIEERKHMTPPPEIAVSREP---- 294

  Fly   436 PAECVEQHQQQHNFGSAAPHR 456
            ||.           ||.|..|
plant   295 PAS-----------GSGAKRR 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycDNP_523355.2 Cyclin_N 155..280 CDD:278560 35/132 (27%)
Cyclin_C 282..>392 CDD:281044 19/127 (15%)
CYCD5;1NP_195478.2 CYCLIN_AtCycD-like_rpt1 71..170 CDD:410246 30/103 (29%)
CYCLIN_AtCycD-like_rpt2 175..272 CDD:410247 20/147 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10177
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.