DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycD and CYCD3;1

DIOPT Version :9

Sequence 1:NP_523355.2 Gene:CycD / 32551 FlyBaseID:FBgn0010315 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_195142.1 Gene:CYCD3;1 / 829564 AraportID:AT4G34160 Length:376 Species:Arabidopsis thaliana


Alignment Length:189 Identity:51/189 - (26%)
Similarity:91/189 - (48%) Gaps:17/189 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 FLKVEEKHHK-IPDTYFSIQKDITPPMRKIVAEWMMEVCAEENCQEEVVLLALNYMDRFLSSKSV 219
            |.|.||:... :.|.|.|..       ||....|::.|.|.........:||:.|:|:|:.|.|:
plant    67 FSKEEEQGLSCLDDVYLSTD-------RKEAVGWILRVNAHYGFSTLAAVLAITYLDKFICSYSL 124

  Fly   220 RKTQ---LQILAAACLLLASKLREPSCRALSVDLLVVYTDNSIYKDDLIKWELYVLSRLGWDLSS 281
            ::.:   ||:::.|||.||:|:.|... .|.:|..|..|........:.:.||.:||.|.|.:..
plant   125 QRDKPWMLQLVSVACLSLAAKVEETQV-PLLLDFQVEETKYVFEAKTIQRMELLILSTLEWKMHL 188

  Fly   282 VTPLDFLELLMMRLPIGSKNFPDINIGKVRGHAQAFISLAAKEHKFAKFSASTIAASSI 340
            :||:.|::.::.||.:.:....|. :.|......:.||    :.:|..:..|.:||:::
plant   189 ITPISFVDHIIRRLGLKNNAHWDF-LNKCHRLLLSVIS----DSRFVGYLPSVVAAATM 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycDNP_523355.2 Cyclin_N 155..280 CDD:278560 38/127 (30%)
Cyclin_C 282..>392 CDD:281044 13/59 (22%)
CYCD3;1NP_195142.1 CYCLIN_AtCycD-like_rpt1 86..184 CDD:410246 30/105 (29%)
CYCLIN_AtCycD-like_rpt2 189..279 CDD:410247 13/59 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10177
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.