DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycD and CYCD2;1

DIOPT Version :9

Sequence 1:NP_523355.2 Gene:CycD / 32551 FlyBaseID:FBgn0010315 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_001189576.1 Gene:CYCD2;1 / 816782 AraportID:AT2G22490 Length:362 Species:Arabidopsis thaliana


Alignment Length:311 Identity:72/311 - (23%)
Similarity:130/311 - (41%) Gaps:69/311 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 DITPPMRKIVAEWMMEVCAEENCQEEVVLLALNYMDRFLSSKSVRKTQ---LQILAAACLLLASK 237
            |:...:|....:|:::|||..:.....:.|::||:||||:|..:.|.:   .|:||.:||.||||
plant    91 DLDLSVRNQALDWILKVCAHYHFGHLCICLSMNYLDRFLTSYELPKDKDWAAQLLAVSCLSLASK 155

  Fly   238 LREPSCRALSVDLLVVYTDNSIYKDDLIK-WELYVLSRLGWDLSSVTPLDFLELLMMRLPIGSKN 301
            :.|.....: || |.|.....:::...|| .||.|::.|.|.|.::||..|:             
plant   156 MEETDVPHI-VD-LQVEDPKFVFEAKTIKRMELLVVTTLNWRL
QALTPFSFI------------- 205

  Fly   302 FPDINIGKVRGH--------AQAFISLAAKEHKFAKFSASTI-AASSIAASMNGLKWHLRSGHNL 357
              |..:.|:.||        :..||....|..:|..|..|.| ||::::.|::|....:.....|
plant   206 --DYFVDKISGHVSENLIYRSSRFILNTTKAIEFLDFRPSEIAAAAAVSVSISGETECIDEEKAL 268

  Fly   358 HFLLSLMTDLTSVEQAQVRDCMLHMEDIFKEHSRNLEPFLVNIDPKEMSTLYYKRRFQIHQSQHL 422
            ..|:.:.      :|.:|:.|:..|..:..|.         |:....:             ||..
plant   269 SSLIYVK------QQERVKRCLNLMRSLTGEE---------NVRGTSL-------------SQEQ 305

  Fly   423 SQISIRPLPLPKA---PAECVEQHQQQHNFGSAAPHRTHTCKMQAQAQAQN 470
            :::::|.:|....   .|.|:....::..        ..:|...:|:...|
plant   306 ARVAVRAVPASPVGVLEATCLSYRSEERT--------VESCTNSSQSSPDN 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycDNP_523355.2 Cyclin_N 155..280 CDD:278560 36/107 (34%)
Cyclin_C 282..>392 CDD:281044 25/118 (21%)
CYCD2;1NP_001189576.1 Cyclin_N 65..196 CDD:278560 36/106 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10177
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.