DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycD and CCNP

DIOPT Version :9

Sequence 1:NP_523355.2 Gene:CycD / 32551 FlyBaseID:FBgn0010315 Length:477 Species:Drosophila melanogaster
Sequence 2:XP_006723458.2 Gene:CCNP / 79935 HGNCID:25805 Length:397 Species:Homo sapiens


Alignment Length:305 Identity:76/305 - (24%)
Similarity:129/305 - (42%) Gaps:59/305 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 PPPPPTATQSIQSYPRYISQEP------------PTSHCQRLDERLTTTADPPATDNVNTAIGDP 145
            |.|.|     :||....:..||            ||...:||       |.||..:...:|:|  
Human    91 PRPSP-----LQSLAASLDAEPSSAAVPDGFPAGPTVSPRRL-------ARPPGLEEALSALG-- 141

  Fly   146 TLYSDRCLENFLKVEEKHHKIPDTYFSIQKDITPPMRKIVAEWMMEVCAEENCQEEVVLLALNYM 210
             |..:|.....:..|....::.... ::.:.:||.||.:|.:|:::|........:.:.||::.:
Human   142 -LQGEREYAGDIFAEVMVCRVLPLR-ALPRAVTPEMRALVVDWLVQVHEYLGLAGDTLYLAVHLL 204

  Fly   211 DRFLSSKSVRKTQLQILAAACLLLASKLREPSCRALSVDLLVVYTDNSIYKDDLIKWELYVLSRL 275
            |.:||:..||..:||:|..|||.:|.|:.|  |.......|.:.:.:|..:.:|::.|..:||||
Human   205 DSYLSAGRVRLHRLQLLGVACLFVACKMEE--CVLPEPAFLCLLSADSFSRAELLRAERRILSRL 267

  Fly   276 GWDLSSVTPLDFLELLMMRLPIGSKNFPDINIGKVRGHAQAFISLAAKEHKFAKFSASTIAASSI 340
            .:.|....||..|.||...  .||.  |.:.:     .|..|:.|:..|.:.|.:.....||:::
Human   268 DFRLHHPGPLLCLGLLAAL--AGSS--PQVML-----LATYFLELSLLEAEAAGWEPGRRAAAAL 323

  Fly   341 AASMNGLKWHLRSGHNLHFLLS-----LMTDLTSVEQ-AQVRDCM 379
            :.:              |.||.     |..:|.|.|: ..:..||
Human   324 SLA--------------HRLLDGAGSRLQPELYSPEELGTLEPCM 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycDNP_523355.2 Cyclin_N 155..280 CDD:278560 33/124 (27%)
Cyclin_C 282..>392 CDD:281044 24/104 (23%)
CCNPXP_006723458.2 Cyclin_N 171..271 CDD:278560 32/101 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146237
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.