DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycD and CCNJL

DIOPT Version :9

Sequence 1:NP_523355.2 Gene:CycD / 32551 FlyBaseID:FBgn0010315 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_078841.3 Gene:CCNJL / 79616 HGNCID:25876 Length:435 Species:Homo sapiens


Alignment Length:356 Identity:67/356 - (18%)
Similarity:125/356 - (35%) Gaps:124/356 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 LALNYMDRFLSSKSVRKT-QLQILAAACLLLASKL------------------------------ 238
            ||:..:|.|:...:|..: ||..:|.:|||||:.:                              
Human    62 LAVYLLDHFMDRYNVTTSKQLYTVAVSCLLLANGVSLLSPRLKCSGMISAHCNLHLPGSSNSPAS 126

  Fly   239 --------------------RE---PSCRALSVDLLVVYTDNSIYKDDLIKWELYVLSRLGWDLS 280
                                ||   |....::...::...:.::.|.:|:..||.:|....|:|.
Human   127 APHPPPTPPQVAETTGKFEDREDHVPKLEQINSTRILSSQNFTLTKKELLSTELLLLEAFSWNLC 191

  Fly   281 SVTPLDFLELLMMRLPIGSKN-----FPDINIGK----VRGHAQAFISLAAKEHKFAKFSASTIA 336
            ..||..||:..:: ..:..|:     :|.....|    ::.:|..|:.:..::|.|.||..|.:|
Human   192 LPTPAHFLDYYLL-ASVSQKDHHCHTWPTTCPRKTKECLKEYAHYFLEVTLQDHIFYKFQPSVVA 255

  Fly   337 ASSIAASMNGLK----W----HLRSGHNLHFLLSLMTDLTSVEQAQVRDCM------LHM----- 382
            |:.:.||...|:    |    ...|.::|..|.:.:..|..|....::|.:      |.|     
Human   256 AACVGASRICLQLSPYWTRDLQRISSYSLEHLSTCIEILLVVYDNVLKDAVAVKSQALAMVPGTP 320

  Fly   383 ----EDIFK--------EHSRNLEPFLVNIDPKEMSTLYYKRRFQIHQS---------------- 419
                :.:|:        :.:..|..|..   |.:...|.|:...|.|:|                
Human   321 PTPTQVLFQPPAYPALGQPATTLAQFQT---PVQDLCLAYRDSLQAHRSGSLLSGSTGSSLHTPY 382

  Fly   420 QHLSQISIRPLPLPKA----------PAECV 440
            |.|..:.:.|:|:|.:          |..|:
Human   383 QPLQPLDMCPVPVPASLSMHMAIAAEPRHCL 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycDNP_523355.2 Cyclin_N 155..280 CDD:278560 22/128 (17%)
Cyclin_C 282..>392 CDD:281044 29/149 (19%)
CCNJLNP_078841.3 CYCLIN 14..>93 CDD:294043 11/30 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 120..142 0/21 (0%)
Cyclin_C 193..>295 CDD:281044 23/102 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146233
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.