DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycD and ccndx

DIOPT Version :9

Sequence 1:NP_523355.2 Gene:CycD / 32551 FlyBaseID:FBgn0010315 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_001016108.1 Gene:ccndx / 548862 XenbaseID:XB-GENE-483042 Length:290 Species:Xenopus tropicalis


Alignment Length:280 Identity:100/280 - (35%)
Similarity:152/280 - (54%) Gaps:28/280 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 AIGDPTLYSDRCLENFLKVEEKHHKIPD-TYF-SIQKDITPPMRKIVAEWMMEVCAEENCQEEVV 203
            |..||.|...|.|...|.:||::  ||. :|| .:|:||.|.||.::..||:|||.::.|.|||.
 Frog    16 ARADPVLMQSRVLMKLLALEERY--IPSASYFRCVQRDIQPYMRHMLTCWMLEVCEDQKCGEEVF 78

  Fly   204 LLALNYMDRFLSSKSVRKTQLQILAAACLLLASKLREPSCRALSVDLLVVYTDNSIYKDDLIKWE 268
            .||:|.:||:||...|.|..||:|.|.||.|||||||  .:.::.:.|.:|:|:.....:|:..|
 Frog    79 PLAVNCLDRYLSLVPVEKRHLQLLGATCLFLASKLRE--SKPMTAESLCMYSDHCFTDKELLAME 141

  Fly   269 LYVLSRLGWDLSSVTPLD----FLELLMMRLPIGSKNFPDINIGKVRGHAQAFISLAAKEHKFAK 329
            |.||::|.|||..|||.:    |||||         |.|.....:||.|::.||:|...:..|..
 Frog   142 LLVLNKLKWDLEVVTPREYLPHFLELL---------NIPAEKRPQVRKHSETFIALCTTDCTFIA 197

  Fly   330 FSASTIAASSIAASMNGLKWHLRS-GHNLHFL--LSLMTDLTSVEQAQVRDCM----LHMEDIFK 387
            ...|.:||:|:||::.||:  |:| |.:...|  ::|:......:.:.:|.|.    :.:|...:
 Frog   198 LPPSMVAAASVAAAVTGLQ--LQSPGPSYSSLASINLLAHAIHCDPSLLRACQEQIEISLESSVQ 260

  Fly   388 EHSRNLEPFLVNIDPKEMST 407
            ...||......::|..|.|:
 Frog   261 RAQRNRVSESKSVDEPERSS 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycDNP_523355.2 Cyclin_N 155..280 CDD:278560 55/126 (44%)
Cyclin_C 282..>392 CDD:281044 33/120 (28%)
ccndxNP_001016108.1 Cyclin_N 31..152 CDD:365896 54/124 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 126 1.000 Domainoid score I5337
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 180 1.000 Inparanoid score I3884
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001275
OrthoInspector 1 1.000 - - otm72281
Panther 1 1.100 - - O PTHR10177
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.