DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycD and Ccno

DIOPT Version :9

Sequence 1:NP_523355.2 Gene:CycD / 32551 FlyBaseID:FBgn0010315 Length:477 Species:Drosophila melanogaster
Sequence 2:XP_006232009.1 Gene:Ccno / 499528 RGDID:1565217 Length:352 Species:Rattus norvegicus


Alignment Length:358 Identity:81/358 - (22%)
Similarity:136/358 - (37%) Gaps:72/358 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 PPPPPPPPPPTAT------QSIQS------YPRYISQEP--PTSHCQ--------RLDERLTTT- 129
            |.|..|..|.:..      |::::      .||...:||  |.:.|.        .|.|..::: 
  Rat     4 PCPASPASPASGAGRQDNHQNLRAPVKKSRRPRLRRKEPLRPLNACSLPGDSGVCDLFESPSSSS 68

  Fly   130 --ADPPATDNVN------------TAIGDPTL--YSDRCLENFLKVEEK-HHKIPDTYFSIQKDI 177
              ||.||...|.            ||:...|.  |...|.: |.|.:|. .|  |....:.|..:
  Rat    69 DGADSPAVSAVRDCSSLLSSAQPLTALDLQTFREYGQSCYD-FRKAQENLFH--PRESLARQPQV 130

  Fly   178 TPPMRKIVAEWMMEVCAEENCQEEVVLLALNYMDRFLSSKSVRKTQLQILAAACLLLASKLREPS 242
            |...|..:..|:::|..:.....|.:.|.:|.:||||.:..|.....|:|...|||:|       
  Rat   131 TAESRCKLLSWLLQVHRQFGLSFESLCLTVNTLDRFLLTTPVAADCFQLLGVTCLLIA------- 188

  Fly   243 CRALSV-----DLLVVYTDNSIYKDDLIKWELYVLSRLGWDLSSVTPLDFLE-LLMMRLPIGSKN 301
            |:.:.|     ..|:.....:..:..|...|..||.:|.:.|.:.|...||| ....|:..|...
  Rat   189 CKQVEVHPPRMKQLLALCGGAFSRQQLCNLECIVLHKLHFSLGAPTINFFLEHFTHSRVEAGQVE 253

  Fly   302 FPDINIGKVRGHAQAFISLAAKEHKFAKFSASTIAASSIAASMNGLKWHLRSGHNLHFLLSLMTD 366
            ..:....:......|.:||.  ::.|..::.|.:|...:|.:...|: |.|           :.|
  Rat   254 VTEALAAQTLARGVAELSLT--DYAFTTYTPSLLAICCLALADRMLR-HQR-----------LMD 304

  Fly   367 LTSVE--QAQVRDCMLHMEDIFKEHSRNLEPFL 397
            |...|  :|.:.||:..::.:...:|.:|...|
  Rat   305 LRLGEHPEATLLDCLGKLQKLVSINSSSLTHML 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycDNP_523355.2 Cyclin_N 155..280 CDD:278560 32/130 (25%)
Cyclin_C 282..>392 CDD:281044 23/112 (21%)
CcnoXP_006232009.1 Cyclin_N 108..231 CDD:278560 32/132 (24%)
Cyclin_C 233..>298 CDD:281044 13/66 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340010
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.