DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycD and ccnf

DIOPT Version :9

Sequence 1:NP_523355.2 Gene:CycD / 32551 FlyBaseID:FBgn0010315 Length:477 Species:Drosophila melanogaster
Sequence 2:XP_012825809.1 Gene:ccnf / 496496 XenbaseID:XB-GENE-963729 Length:764 Species:Xenopus tropicalis


Alignment Length:299 Identity:59/299 - (19%)
Similarity:125/299 - (41%) Gaps:60/299 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 FSIQKDITPPMRKIVAEWMMEVCAEENCQEEVVLLALNYMDRFLSSKSVRKTQLQILAAACLLLA 235
            |:.||.:...||.|:.:|::||...::.....:.:.:..:||:|..:||.:.:||::..||:::.
 Frog   305 FTTQKGMNDTMRYILIDWLVEVATMKDFSSLCLHMTVGLVDRYLKLRSVPRAKLQLVGIACMVIC 369

  Fly   236 SKLREPSCRALSVDLLVV-----YTDNSIYKDDLIKWELYVLSRLGWDLSSVTPLDFLELLMMRL 295
            :       |.:|.::|.:     .|||:...:||::....::|.|...:...|.:|:.::|...:
 Frog   370 T-------RFISKEILTIREAVWLTDNTYKYEDLVRMMGEIISALEGKIR
MPTVVDYKDVLSHLI 427

  Fly   296 PIGSKNFPDINIGKVRGHAQAFIS-LAAKEHKFAKFSASTIAASSIAAS----MNGLKWHLRSGH 355
            |:.....          |..::|| |:....:.:.:|.:.:||.::..:    .....|..:...
 Frog   428 PLDRSTL----------HLCSYISELSLLYTELSTYSPAQLAAGALLLARILHKQARPWPAQLAE 482

  Fly   356 NLHFLLSLMTDLTSVEQAQVRDCMLHMEDIFKEHSRNLEPFLVNIDPKEMSTLYYKRRF------ 414
            ...|.|..:|...         .:||.:....:..:         |.:::|....|:||      
 Frog   483 TTGFTLEHLTPCV---------VLLHKKCFHDDAPK---------DYRQVSLTAVKQRFQDDLYD 529

  Fly   415 ------QIHQSQHLSQISIRPLPLPKAPAEC---VEQHQ 444
                  |:....||.::...|....::||.|   .:.||
 Frog   530 QISKEKQVMDHSHLCELLGVPCRDSESPASCPNAADFHQ 568

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycDNP_523355.2 Cyclin_N 155..280 CDD:278560 28/113 (25%)
Cyclin_C 282..>392 CDD:281044 17/114 (15%)
ccnfXP_012825809.1 FBOX 34..74 CDD:197608
SLR repeat 87..111 CDD:276807
Cyclin_N 301..412 CDD:365896 28/113 (25%)
Cyclin_C 430..533 CDD:367282 18/130 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.