DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycD and ccni

DIOPT Version :9

Sequence 1:NP_523355.2 Gene:CycD / 32551 FlyBaseID:FBgn0010315 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_998386.1 Gene:ccni / 406239 ZFINID:ZDB-GENE-040426-2898 Length:355 Species:Danio rerio


Alignment Length:338 Identity:79/338 - (23%)
Similarity:130/338 - (38%) Gaps:58/338 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 LENFLKVEEKHHK--IPDTYFSIQKDITPPMRKIVAEWMMEVCAEENCQEEVVLLALNYMDRFLS 215
            ||..:..|.|..|  :|....:...||:|..|.....|:.:|.::.....|.:.||:..:|||||
Zfish    16 LEKAVSREAKLWKVYVPKKPTNQDTDISPEKRDEAVRWLRDVHSQLKLYPETLCLAIGILDRFLS 80

  Fly   216 SKSVRKTQLQILAAACLLLASKLREPSCRALSVDLLVVYTDNSIYKDDLIKWELYVLSRLGWDLS 280
            :...|...|:.:|.:|..||:|..|...|..|:..|...:.......::::.|..||.:|.|||.
Zfish    81 TIKARPKYLRCIAISCFFLAAKTSEEDERIPSLRELASSSKCGCSPSEILRMERIVLDKLNWDLH 145

  Fly   281 SVTPLDFLELL-MMRLPIGSKNFPDINIGKVRGH------AQAFISLAAKEHKFAKFSASTIAAS 338
            |.|.||||.:. .|.|...|........|....|      .|.|..||  .:...:...|.::..
Zfish   146 SATALDFLYIFHAMVLSCKSGRLSAALSGLNPSHHVALLTQQLFHCLA--HNALLQVRGSLLSLG 208

  Fly   339 SIAASMNGL--KWHLRSGHNLHFLLSLMTDL---TSVEQAQVRDCMLHMEDIFKEHSRNLEPFLV 398
            .|...:..|  .|           |:|..||   ..::.:|:..|...:......|:.:|.|   
Zfish   209 LITLELEKLCPDW-----------LALTVDLLHRLQIDSSQLICCRELVARCLSTHTASLPP--- 259

  Fly   399 NIDPKEMSTLYYKRRFQIHQSQHLSQISIRPLPLPKAPAECVEQHQQQHNFGSAAPHRTH--TCK 461
                   :|:|..|.....:.:.:..:|:    .|.||::               |:.||  :.|
Zfish   260 -------NTVYICRPLPEPRDEGVLHVSL----APTAPSD---------------PNSTHSRSAK 298

  Fly   462 MQAQAQAQNEIQD 474
            .:.:....:|..|
Zfish   299 RKVEQMEVDEYYD 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycDNP_523355.2 Cyclin_N 155..280 CDD:278560 35/126 (28%)
Cyclin_C 282..>392 CDD:281044 25/121 (21%)
ccniNP_998386.1 Cyclin_N 31..144 CDD:278560 31/112 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579801
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.