DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycD and Ccnjl

DIOPT Version :9

Sequence 1:NP_523355.2 Gene:CycD / 32551 FlyBaseID:FBgn0010315 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_001038995.1 Gene:Ccnjl / 380694 MGIID:2685723 Length:387 Species:Mus musculus


Alignment Length:318 Identity:68/318 - (21%)
Similarity:126/318 - (39%) Gaps:76/318 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 LALNYMDRFLSSKSVRKT-QLQILAAACLLLASKLREPSCRALSVDLL----VVYTDN-SIYKDD 263
            ||:..:|.|:...::..: ||..:|.:|||||||..:...|...::.:    ::.:.| |:.|.:
Mouse    61 LAIYLLDHFMDQYNITTSKQLYTVAVSCLLLASKFEDREDRVPKLEQINNTRILSSQNFSLTKKE 125

  Fly   264 LIKWELYVLSRLGWDLSSVTPLDFLELLMMRLPIGSKN-----FPDINIGK----VRGHAQAFIS 319
            |:..||.:|....|||...||..||:..:: ..|..|:     :|...:.|    ::.:|..|:.
Mouse   126 LLTTELLLLEAFSWDLCLPTPAHFLDYYLL-ASISQKDHHCHAWPTTCLRKTKECLKEYAHYFLE 189

  Fly   320 LAAKEHKFAKFSASTIAASSIAASMNGLK----W----HLRSGHNLHFLLSLMTDLTSVEQAQVR 376
            :..::|.|.||..|.:||:.:.||...|:    |    ...|.::|..|.:.:..|.......::
Mouse   190 VTLQDHIFYKFQPSVVAAACVGASRICLQLSPYWTRDLQRVSSYSLEHLSTCIEILLVAYDNVLK 254

  Fly   377 DCM-LHMEDIFKEHSRNLEPFLVNIDPKEMST--------------------LYYKRRFQIHQS- 419
            |.: :..:.:......:..|..|...|....|                    |.|:...|.|:| 
Mouse   255 DAVAVKSQTLAMVPGSSSAPAQVLFQPPTYPTLSQPPPTTLAQFQSPAQDLCLAYRDSLQAHRSG 319

  Fly   420 ---------------QHLSQISIRPLPLPKA----------PAECVEQHQQQHNFGSA 452
                           ..|..:.:.|:|:|.:          |..|:..     ::||:
Mouse   320 GLLSGDTGPSLHTPYPTLQPLDMCPVPVPASLSMQMAIAAEPRHCLTA-----SYGSS 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycDNP_523355.2 Cyclin_N 155..280 CDD:278560 24/80 (30%)
Cyclin_C 282..>392 CDD:281044 26/127 (20%)
CcnjlNP_001038995.1 CYCLIN 13..>106 CDD:294043 15/44 (34%)
Cyclin_C 144..>246 CDD:281044 24/102 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836332
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.